SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1P7U3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1P7U3
Domain Number 1 Region: 115-326
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.98e-54
Family DBL homology domain (DH-domain) 0.0000768
Further Details:      
 
Domain Number 2 Region: 342-459
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-20
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1P7U3
Sequence length 555
Comment (tr|F1P7U3|F1P7U3_CANLF) Neuroepithelial cell transforming 1 {ECO:0000313|Ensembl:ENSCAFP00000007839} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=NET1 OC=Canis.
Sequence
NRYSLRRGSSFTFLTPGPHWDFTLKRKRRAKDDDVVSLNSLDLKEPSNKRVRPLARVTSL
ANLISPVRNGAVRRFGQTIQSFTLRGDSRSPASAQKSSSRSTVPTPAKRRSSVLWSEMLD
VSMKESLTTKEIKRQEAIYEMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGD
LDAYIPLHEDLLARIGEATKPGGTVEQIGHILVNWLPGLNAYKGYCSNQLAAKALLDQKK
QDPRVQDFLQRCLESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHPDVQPLEE
AILIIQGVLSDINLKKGESECQYYIDKLEYLDEKQKDPRIEASKVLLCHGELKNKNGHKL
YIFLFQDILVLTRPVTRNERHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSDK
AKNIFRVRFQDPSPGQSHTLQANDVFHKQQWFNCIRSAIAPFQQAVGPADLQGLPELDEE
CGENDPSAGSIRARRRASTASSMTQVQVDGDTSECVSPVHTAEDVKSVKVHQTQSGFRKA
RDKAQFSGKRKETLV
Download sequence
Identical sequences F1P7U3
ENSCAFP00000007839 ENSCAFP00000007839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]