SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1P945 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1P945
Domain Number 1 Region: 542-693
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-67
Family Ankyrin repeat 0.0000000477
Further Details:      
 
Domain Number 2 Region: 32-270,303-328
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.42e-66
Family BAR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 420-538
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.000000936
Further Details:      
 
Domain Number 4 Region: 301-409
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-21
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 5 Region: 932-1006
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-16
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1P945
Sequence length 1008
Comment (tr|F1P945|F1P945_CANLF) ArfGAP with SH3 domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSCAFP00000005006} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=ASAP2 OC=Canis.
Sequence
MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKA
INISGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMN
NIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISG
AEIAEEMEKERRLFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVES
LKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDSQIRQSTAYSLHQPQG
NKEHGTERNGNLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVKTNP
EEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELT
KEIISEVQKMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDV
LGTSELLLAKNIGNAGFNEIMEYCLPAEDSVKPNPGSDMNARKDYITAKYIERKYARKRH
ADNAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTS
LHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIETANESGETPLDI
AKRLRHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDVDEKLQPSPSRREDRP
VSFYQLGSNQLQSNAASLARDAASLAKDKQRSFVPSILQNETYGAILSGSPPPTQPAAPS
TASAPPLPPRNVAKVQTASSATALWKTNSVSVDGASRQRSSSDPPAVHPPLPPLRVTSTN
PLAPTPPPPVAKTPSVIEALNQQSKPAQPGISLSKAPPPPLPPQPPSRLPQKRPAPGADK
STPLINKGQPRGPADLSGTEVLGPLSNTGVLQPPAPMPRKSQTTKLKPKRVKALYNCVAD
NPDELTFSEGDVIIVDGEEDQEWWIGHIDGDPSRKGAFPVSFVHFIAD
Download sequence
Identical sequences F1P945
XP_532867.3.84170 ENSCAFP00000005006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]