SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PAC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PAC5
Domain Number 1 Region: 113-377
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.59e-76
Family Protein kinases, catalytic subunit 0.0000154
Further Details:      
 
Domain Number 2 Region: 37-110
Classification Level Classification E-value
Superfamily SH3-domain 1.23e-20
Family SH3-domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1PAC5
Sequence length 630
Comment (tr|F1PAC5|F1PAC5_CANLF) Mitogen-activated protein kinase kinase kinase 11 {ECO:0000313|Ensembl:ENSCAFP00000019767} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=MAP3K11 OC=Canis.
Sequence
MEPLKNLFLKSPLGSWNSSGGGGSGGSGGGWPEGSPKTAAYANPVWTALFDYEPNGQDEL
ALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRLE
EVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALK
AVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHR
DLKSNNILLLQPIEGDDMDHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTFS
KGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCWA
QDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLSR
EEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFKR
SKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGAGDSPTFPRFRAIQLEPAEP
GQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRLDEAAWYLDSDDSSSL
GSPSTPPMLNGNPPRPRGSPEPEEPRRPGL
Download sequence
Identical sequences F1PAC5
XP_540853.4.84170 ENSCAFP00000019767 ENSCAFP00000019767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]