SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PAT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PAT5
Domain Number 1 Region: 721-948
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-59
Family DBL homology domain (DH-domain) 0.000000000976
Further Details:      
 
Domain Number 2 Region: 324-502
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.62e-54
Family Regulator of G-protein signaling, RGS 0.0000000367
Further Details:      
 
Domain Number 3 Region: 952-1086
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-42
Family Pleckstrin-homology domain (PH domain) 0.00000036
Further Details:      
 
Domain Number 4 Region: 38-135
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-21
Family PDZ domain 0.024
Further Details:      
 
Weak hits

Sequence:  F1PAT5
Domain Number - Region: 163-173
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00497
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1PAT5
Sequence length 1522
Comment (tr|F1PAT5|F1PAT5_CANLF) Rho guanine nucleotide exchange factor 11 {ECO:0000313|Ensembl:ENSCAFP00000024266} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=ARHGEF11 OC=Canis.
Sequence
LGVLLSLIQRSASKKQSHLSSPIAAWLSTLSLGDPAPERRSPSHLRQPSDTSETAGLVQR
CVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMRAGVKEGDRIIKVNGTMVTNSSHLEVV
KLIKSGAYVALTLLGSSPLSVGVSGLQQDPAPAGAPRVTPVVPPPPPPPPLPPPQRITGP
RPLQDPEFQKHATQILRNMLRQEEKELQDIPTLYSDTSQRASEGRLSLDSQEGDSGMDSG
TERLPSLSEALMNRNSALSDPGLDSPRTSPVIMARVAQHHRRQGSDAPGPSTSEQGTDQS
PKPLIIGPEEDYDPGYFNNESDIVFQDLEKLKARPAHLGVFLRYIFSQADPSPLLFYLCA
EVYQQTNPKDSRGLGKDIWNIFLEKNAPLRVKVPEMLQAEIDLRLRGSEDIRAALHEAQE
AAMPEIQEQIQDYRLRTKRTLGLGSLYGENDLLDLDGDPLRERHVAEKQLAALGDILSKY
EEDRSAPMDFALNTYMNHAGLRVRDARSSSLAEKAQAAPDKDKWLPFFPKTKKQSSNSKK
DKDALEDKRRNPILKYIGKPKSSSQSIKPGNVRNIIQHFENNQPYDAPEPGTQRLSTGSF
PEDLLESDSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEAARLHQSAS
SSASSLSTRSLENPTPPFTPKMGRRSIESPSLGFCTDALLPHLLEDDLGQLSDLEPEPDT
QNWQHTVGKDVVAGLSQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPRE
ELARLFPNLPELIEIHNSWCEAMRKLREEGPIIREIGDLMLARFDGPAREELQQVAAQFC
SYQSIALGLIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESVL
KHTEGGTSEHEKLCRARDQCREILKYVNEAVKQTENQHRLEGYQKRLDTTSLERASNPLA
AEFKSLDLTARRMVHEGPLTWRISKDKSLDLHVLLLEDLLVLLQKQDEKLMLKCHSKTAA
GTSDNKQTFSPVLKLNAVLIRSVATDKRAFFIICTSELGPPQIYELVALTSSDKNTWMEL
LEEAVRNATRHPIAAPVLAHPPPPDAQEPAHQSPIPTRVGLDSSEVFHSEPESGLLPGGP
GPQQRVRGKHPGQLEDPEQESSIEEELGALPHPSASLDGESRGGRTRGPILLPLPGPLFM
EGLADSALEDVERLRHLILCSLLPGHRSEAQPTSEPEDDLTPTPSLVSSACHTGDPSSPG
RAPHGGEGPEQEDMALCSLERLPPRARNSGIWESPELDRNPEEEASGTEAAGSYKVVRKG
LCLPGGGGPHAAEVVGSRAVTALPESQSGPEPPEVEGGAKAAGNCFYVSMPAGPPDSTTE
PSQPNSLPVWQTEPEPQAQLQGGSGGCRRPSRSPPSMALRDVGNIFHTIEQLTVKLNRLK
DMELAHRELLRSLAGESSGGTTPVGSFHTEAARWTDHSLSPPAREPLASDSRDSHQPGPC
SEDGSNTPLEDGTTHAASSPGL
Download sequence
Identical sequences F1PAT5
ENSCAFP00000024266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]