SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PB85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PB85
Domain Number 1 Region: 4-411
Classification Level Classification E-value
Superfamily Serpins 5.89e-117
Family Serpins 0.0000000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1PB85
Sequence length 414
Comment (tr|F1PB85|F1PB85_CANLF) Serpin family A member 7 {ECO:0000313|Ensembl:ENSCAFP00000026397} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=SERPINA7 OC=Canis.
Sequence
MPLFLYLALLVLELHCASSIRSEGKVITCNSPPKNATFYKMSSINADFAFNLYRRFTVET
PDRNIFFSPVSISAALAMLSFGACYSTQIQILESLGFNLTDTPMAEIQQGFQHLICSLNI
PKKELELQMGNTLFIGKQLKPLAQFLDDVKSLYATEVFSTDFSNVSAAQQLINSHVEKQT
KGEVVGLIQDLKPNTIMVLVNYIHFKAQWANPFDPSKTEEGFSFSVDKTTTVKVPMMHQM
EQYYHLVDTELNCTVLQMDYSKNALALFVLPKEGQIEWVEGAMSSKTLKKWNRLLQKGWI
DLFVPKFSISATHDLGATILKMGIQDAFADNANFRGLMGNNGLKFSKAAHKAVLHIGEKG
TEALLVPEVRFLDQPEITLLHPIIQFDRSFLLLILEKSTRSILFLGKVVNPMEV
Download sequence
Identical sequences F1PB85
ENSCAFP00000026397 ENSCAFP00000026397 XP_005641679.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]