SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PBG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PBG1
Domain Number 1 Region: 299-466,545-715
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.4e-126
Family Mammalian PLC 0.000000671
Further Details:      
 
Domain Number 2 Region: 141-298
Classification Level Classification E-value
Superfamily EF-hand 7.78e-45
Family EF-hand modules in multidomain proteins 0.011
Further Details:      
 
Domain Number 3 Region: 733-849
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.13e-28
Family PLC-like (P variant) 0.00068
Further Details:      
 
Domain Number 4 Region: 15-127
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-25
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1PBG1
Sequence length 1206
Comment (tr|F1PBG1|F1PBG1_CANLF) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=PLCH1 OC=Canis.
Sequence
MADLEVYKNLSPEKVERCMSVMQSGTQMIKLKRGTKGLVRLFYLDEHRTRLRWRPSRKSE
KAKILIDSIYKVTEGRQSEIFHRQAEGHFDPSCCFTIYHGNHMESLDLITSNPEEARTWI
TGLKYLMAGISDEDSLAKRQRTHDQWVKQTFEEADKNGDGLLNIEEIHQLMHKLNVNLPR
RKVRQMFQEADTDENQGTLTFEEFCVFYKMMSLRRDLYLLLLNYSDKKDHLTLEELAQFL
KVEQKMSNVTTDYCLDIVRKFEVSEENKAKNVLGIEGFTNFMRSPACDIFNPLHHEVYQD
MDQPLCNYYIASSHNTYLTGDQLLSQSKVDMYARVLQEGCRCVEVDCWDGPDGEPVVHHG
YTLTSKILFRDVVETINKHAFVKNEFPVILSIENHCSVQQQRKIAQYLKGIFGDKLDLSS
VDTGETKQLPSPQSLKGKILVKGKKLPYHLGDDAEEGEVSDEDSADEIEDECKFKLHYNN
GTTEHQVESFIRKKLESLLKESQIRDKEDPDSFTVRALLRATHEGLNAHLKQHPDVKENG
KKSHGRSLMTNFGKHKKTTKSRSKSYSTDDEEDTQQNPGKETGQLYRLGRRRKTMKLCRE
LSDLVVYTNSVAAQDIVDDGTTGNVLSFSETRAHQVVQQKSEQFMIYNQKQLTRIYPSAY
RIDSSNFNPLPYWNAGCQLVALNYQSEGRMMQLNRAKFKTNGNCGYVLKPQQMCKGTFNP
YSGDPLPANPKKQLILKVISGQQLPKPPDSMFGDRGEIIDPFVEVEIIGLPVDCCKDQTR
VVDDNGFNPVWEETLTFTVHMPDIALVRFLVWDHDPIGRDFVGQRTVTFSSLVPGYRHVY
LEGLTEASIFVHITINEIYGKWSPLILNPSYTILHFLGATKSRQLQGLKGLFNKNPRHGS
SENNSHYVRKRSIGDRILRRTASAPAKGRKKSKMGFQEMVEIKDSVSEAARDQDGVLRRT
TRSLQERPVSLPVDKSLLGALSLPLSETAKDTEGKENSLAEDKDGRRKGKASIKDQHFPN
FNKKLSSSSSALLHKDPRPGGSAVSVASASSASVTGEQLGAPGLRGGRTRSPAPGDCQEQ
ECPRKPRSPRQHLALEPALTAAQGGVSTQAPARAGGLGEDGSPRSGSRFSQSHLEGRDLE
GSWVTGRAAASLSLSDVSLLCAAHPDSHSAAVLQESDISHLLDTVPLATEGDPGSSISAL
VGQCED
Download sequence
Identical sequences F1PBG1
ENSCAFP00000012868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]