SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PBI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PBI9
Domain Number 1 Region: 895-1029
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.02e-24
Family Myotubularin-like phosphatases 0.00093
Further Details:      
 
Domain Number 2 Region: 664-805
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000215
Family GRAM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1PBI9
Sequence length 1117
Comment (tr|F1PBI9|F1PBI9_CANLF) SET binding factor 1 {ECO:0000313|Ensembl:ENSCAFP00000000866} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=SBF1 OC=Canis.
Sequence
MPGAPGAALPSPIQVPLLSPTLLPSPSSPPRALRHRALRCYSFTYVPILPAQLLEVLSTP
TPFIIGVNAAFQAETQELLDVIVADLDGGTVTVPECVHIPPLPEPLQSQTHSVLSMVLDP
DLELADLAFPPPTANASSLKMQDKELRAVFLRLFAQLLQGYRWCLHMVRIHPEPVIRFHK
AAFLGQRGLMEDDFLMKVLEGMAFAGFVSERGVPYRSTDLFDELVAHEVARMRADENHPQ
RVLRHVKELAEQLYKNENPYPAVAMHKVQRPGEASHLRRVPRPFPRLDDGMVQWIVDQAA
AKMQGAPPAVKAERRTTVPSGPPMTAILERSSGLHGNSARRLEVVRNCISYVFEGKMLEA
KKLLPAVLRALKGRAARRCLTQELHLHVQQNRAVLDHQQFDFVVRMMNCCLQDCTSLDEH
GIAAALLPLVTAFCRKLSPGVTQFAYSCVQEHVVWSTPQFWEAMFYGDVQTHIRALYLEP
AEDQDHLQVGDASTQEDERSALDVASEQRRLWPTLSREKQQELVQKEESTVFSQAIHYAN
RMSYLLLPLDSSKSRLLRERAGLGDLESASNSLVTNSMAGSVAESYDTESGFEDAETCDV
AGAVVRFINRFVDKVCTESGVTSDHLKGLHVMVPDIVQMHIETLEAVHRESKRLPPIQKP
KLLRPRLLPGEECVLDGLRVYLLPDGREEGAGGSGGGPALLPAEGAVFLTTYRVIFTGMP
TDPLVGEQVVVRSFPVATLTKEKRISVQTPVDQLLQDGLQLRSCTFQLLKMAFDEEVGSD
SAELFRKQLHKLRYPPDIRGTFAFTLGSTHAPGRPPRTTKDKGPSLRTLSRNLVKNAKKT
IGRQYVTRKKYNPPSWEHRGQPPPEDQEDEISVSEELEPSTLTPSSALKPSDRMTMSSLV
ERACCRDYQRLGLGTLSSSLSRAKSEPFRISPVNRMYAICRSYPGLLIVPQSVQDNALQR
VSRCYRQNRFPVVCWRSGRSKAVLLRSGGLHGKGVVGLFKAQNTPSPGQSQADSGSLEQE
KYLQAVAPYLDCYADASGRNTLSGFSSAHVGGHVPSPRARVTTLSNPMAASASRRTAPRG
TVLAAQAGSPTPGTDAPHVTEHSWALTSPAAGTNSPV
Download sequence
Identical sequences F1PBI9
ENSCAFP00000000866 ENSCAFP00000000866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]