SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PCK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PCK0
Domain Number 1 Region: 70-181
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-28
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-18
Family PDZ domain 0.0092
Further Details:      
 
Domain Number 3 Region: 204-247
Classification Level Classification E-value
Superfamily PH domain-like 0.0000025
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1PCK0
Sequence length 256
Comment (tr|F1PCK0|F1PCK0_CANLF) Uncharacterized protein {ECO:0000313|Ensembl:ENSCAFP00000031457} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=LOC102151511 OC=Canis.
Sequence
GDYPWGFRIEFSKPIVVTEVDANSAAEEAGLQMGDVVLAVNGTEVTSVEHAEAVHLARKG
PDILTLVVGSDISRCPNTPWPTCRGYLHKRTHSGFVKGWRKRWFVLKHDGCLHYYRHKKD
EGKCPPLEIIKLEGAEVGMDSSLGKPFVFNCVPQSGNRAFCLCATSNQEMKRWLEAMDKA
THPVRQTHVWEDVTLHNSSLPPLAIKNPECLGLLHQLDRSTDMWVQHYCILKDGCLYLYA
SIRSTQASVSYILIKL
Download sequence
Identical sequences F1PCK0
ENSCAFP00000031457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]