SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PEM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PEM6
Domain Number 1 Region: 5-143
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-45
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000192
Further Details:      
 
Weak hits

Sequence:  F1PEM6
Domain Number - Region: 192-319
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0734
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1PEM6
Sequence length 360
Comment (tr|F1PEM6|F1PEM6_CANLF) Homer scaffolding protein 3 {ECO:0000313|Ensembl:ENSCAFP00000021383} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=HOMER3 OC=Canis.
Sequence
MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAII
NSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKS
QDGGELTSPALALAAHQVPPSPLVSANGPGDEKLFRSQSADVPGPAERERLKKMLSEGSV
GEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAAV
AEPPSVSEKEGPGQSLEQLEALVQTKDQEIQTLKSQTGATREALDATEREEAQQKVQDLE
TRNAELEHQLRATERSLEEARAERERARAEVGRAAQLLDVRLFELSELREGLARLAEGTP
Download sequence
Identical sequences F1PEM6
ENSCAFP00000021383 ENSCAFP00000021383 XP_005632732.1.84170 XP_541929.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]