SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PG30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PG30
Domain Number 1 Region: 263-589
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.62e-127
Family Mammalian PLC 0.0000000453
Further Details:      
 
Domain Number 2 Region: 106-262
Classification Level Classification E-value
Superfamily EF-hand 3.04e-47
Family EF-hand modules in multidomain proteins 0.00038
Further Details:      
 
Domain Number 3 Region: 607-732
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.41e-29
Family PLC-like (P variant) 0.0001
Further Details:      
 
Domain Number 4 Region: 24-96
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000889
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1PG30
Sequence length 741
Comment (tr|F1PG30|F1PG30_CANLF) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=PLCD4 OC=Canis.
Sequence
KEYKNVLYRVKAEEDGLHSNHQTQTRRGNAKPTFSISDVETVREGHESELLRSLAEEFPL
ERGFTIIFHGRRANLDLVANSVEEAEVWKRGLWHLMDFVNGMDQQERLDQWLSDWFQRGD
KNQDGRMSFQEVQRLLHLMNVEMDQEYAFHLFQTADTSHSGTLEGEEFVDFYKALTKRAE
VQELFENFSADGQKLTLLEFVDFLREEQKEGERAPDLALELIDRYEPSESGKLRHVLSMD
GFLSYLCSKDGDIFKPTCLPIYQDMTQPLNNYYINSSHNTYLVGDQLYGQSSVEGYIRAL
KRGCRCVEVDIWDGPSGEPIVYHGHTLTSRIPFKDVVATVAQYAFQTSEYPVILSLENHC
SWEQQQVMACHLTEILGEQLLSTTLDGLLPTQLPSPEELRRKILVKGKKLRTLEEDLEEE
EEEELESELEGEQEADPEPEAQLESEPQELSPRSKDKKKKSKPILCPSLSALVVYLKSVS
FHSFTHSREHYRFYETSSFSETKAKSLIKEAGNEFVQHNAWQLSRVYPSGLRTDSSNYNP
QELWNAGCQMGSSVAMNVQTAGLEMDICDGLFRQNGGCGYVLKPDFLRDAQSSFHPERPV
SPFRAQTLLIQVISGQQLPKEDMSKERSIVDPLVRVEIFGVRPDTTRQETSYVENNGFNP
YWGQTLCFRVLVPELALLRFVVKDYNWKSRNDFIGQYTLPWTCMQQGYRHIHLLSKDGTS
LHPASIFVHINIREGLEGDEC
Download sequence
Identical sequences F1PG30
ENSCAFP00000021853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]