SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PGD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PGD7
Domain Number 1 Region: 3-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.98e-20
Family Ribosomal protein L24e 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1PGD7
Sequence length 156
Comment (tr|F1PGD7|F1PGD7_CANLF) Ribosomal protein L24 {ECO:0000313|Ensembl:ENSCAFP00000014113} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=RPL24 OC=Canis.
Sequence
RVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKK
GQSEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQA
SKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR
Download sequence
Identical sequences A0A0H2UH99 A0A286X7X2 F1PGD7 F6TKN9 F6Y6W2 M3W052
ENSSTOP00000013125 ENSECAP00000021530 ENSCAFP00000014113 ENSSTOP00000013125 ENSMMUP00000019735 9544.ENSMMUP00000019735 9796.ENSECAP00000021530 ENSECAP00000021530 ENSFCAP00000003066 ENSCAFP00000014113 ENSMMUP00000019735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]