SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PHV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PHV1
Domain Number 1 Region: 88-99,174-423
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.11e-50
Family Nuclear receptor ligand-binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 15-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1PHV1
Sequence length 437
Comment (tr|F1PHV1|F1PHV1_CANLF) Nuclear receptor subfamily 6 group A member 1 {ECO:0000313|Ensembl:ENSCAFP00000029989} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=NR6A1 OC=Canis.
Sequence
METWEVSVPDDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNC
VMSRKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISEEEIERIMSGQEF
EEEANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSRSVELNGFMAFREQYMGMSMPPHY
QYIPHLFSYSTHSPLLPPQARSLDPQSYSLIHQLVSAEDLEPLGTPMLIEDGYAVTQAEL
FALLCRLADELLFRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGE
LADVTAKYSPSDEELHRFSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIR
GLTSASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLP
LLFKVVLHSCKTSVGKE
Download sequence
Identical sequences F1PHV1
XP_005625441.1.84170 ENSCAFP00000029989 ENSCAFP00000029989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]