SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PIU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PIU6
Domain Number 1 Region: 93-532
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.01e-78
Family Integrin alpha N-terminal domain 0.00000123
Further Details:      
 
Domain Number 2 Region: 862-1100
Classification Level Classification E-value
Superfamily Integrin domains 1.52e-50
Family Integrin domains 0.00082
Further Details:      
 
Domain Number 3 Region: 532-698
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-31
Family Integrin domains 0.0056
Further Details:      
 
Domain Number 4 Region: 699-853
Classification Level Classification E-value
Superfamily Integrin domains 3.92e-23
Family Integrin domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1PIU6
Sequence length 1196
Comment (tr|F1PIU6|F1PIU6_CANLF) Integrin subunit alpha 7 {ECO:0000313|Ensembl:ENSCAFP00000000074} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=ITGA7 OC=Canis.
Sequence
LAGVGGAGRPGGGRGVARRGTARPLQTCGTRDRRAAVGDLGLRHQRVFALVGSAPSVRRM
AGARGRGPWGPPGIRCLLGSLLAALLAPGAVAFNLDVTGALSKEGEPGSLFGFSVALHRQ
LQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDRGADVQKESKEN
QWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDVIGRCFVLSQDLAARDELDGGEW
KFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGLLFVTNIDSSDPDQLVY
KTLDPADRLPGPAGDLALNSYLGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVILRKDS
ASRLVPEVMLSGERLTSGFGYSLAVADLNNDGWTDLVVGAPYFFERQEELGGAVYVYLNQ
GGHWAGVSPLRLCGSPDSMFGISLAVLGDLNQDGFADIAVGAPFDGDGKVFIYHGSSLGV
VVKPSQVLEGEAVGVKSFGYSLSGGLDVDGNHYPDLLVGSLADTAVLFRARPILQVSHEV
FIAPRTIDLEQPNCAAGHLVCVDLRVCFSYIATPSSYSPIVALDYVLDGDTDRRLRGQVP
RVTFLSRGPDDPKHQSSGTVWLKHQHDRVCGDTMFQLQENVKDKLRAIVVTLSYNLQTPR
LRRQAPGQGLPPVAPILNAHQSSTQRTEIHFLKQGCGEDKVCQSNLQLVQARFCARVSDS
EFQPLPMDADGTTALFALSGQPVIGLELTVTNLPSDPAQPQADGDDAHEAQLLVTLPASL
HYSGVRALDPAEKPLCVSNENASHVECELGNPMKRGAQVTFYLILSTSGITIETTELEVE
LLLATISEQDLHLISVRARVFIELPLSIAGVAVPQQLFFSGVVRGESAMKSERDIGSKVK
YEVTVSNQGQSLNTLGSAFLNIMWPHEIANGKWLLYPMRVELEGGQGPRRKGLCSPRPNI
LHLDVDSRDRRRRELEQPKQEEHPEHLEPSTSWWPVSSAEKKKNITLDCARGTANCVVFS
CPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVTVRANITVKSSIKNLVLRDASTVIP
VMVYLDPVAVVAEGVPWWVILLAVLAGLLVLALLVLLMWKMGFFKRARYPEATVPQYHAV
KIPREDRQQFKEEKTGTILRNNWGSPRREGPDAHPILAADGHPEPGSDGHPMSSTA
Download sequence
Identical sequences F1PIU6
ENSCAFP00000000074 ENSCAFP00000000074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]