SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PL99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PL99
Domain Number 1 Region: 300-609
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.88e-121
Family Mammalian PLC 0.000000285
Further Details:      
 
Domain Number 2 Region: 140-299
Classification Level Classification E-value
Superfamily EF-hand 3.5e-42
Family EF-hand modules in multidomain proteins 0.01
Further Details:      
 
Domain Number 3 Region: 629-754
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.68e-30
Family PLC-like (P variant) 0.00029
Further Details:      
 
Domain Number 4 Region: 11-124
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-29
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1PL99
Sequence length 1001
Comment (tr|F1PL99|F1PL99_CANLF) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=PLCL2 OC=Canis.
Sequence
MPTEKKISSASDCINSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKI
DIKSIKEVRTGKNTDIFRSNGISDQISEDCAFSVIYGENYESLDLVANSADVANIWVTGL
RYLISYGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRDLNPGLKTS
KIELKFKELHKSKDKAGTEVTKEEFVEVFHELCTRPEIYFLLVQFSSNKEFLDTKDLMMF
LEAEQGVAHINEEISLEIINKYEPSKEGQEKGWLSIDGFTKYLMSPDCYIFDPEHKKVCQ
DMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYT
GHTMTSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKILGDKLYTT
LPNVEESYLPSPDVLKGRILIKAKKLSSNCSGVEGDVTDEDEGAEMSQRMGKENVEQPNN
VPVKRFQLCKELSELVSICKSVQFKEFQVSFQVQKYWEVCSFNEVLASKYANENPGDFVN
YNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNFQTPGLMMDLNIGWFRQNGNCGY
VLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVVDPYVYVE
IHGIPADCAEQRTKTVHQNGDAPIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYT
IPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKGKKSREYA
SLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAVSPR
FLGPDNTPLVVLNLSEQYPTMELQGIVPEVLKKIVTTYDMMIQSLKAVIENADAVYEKIV
HCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLK
QIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEKANDETGD
Download sequence
Identical sequences F1PL99
ENSCAFP00000008773 ENSCAFP00000008773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]