SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PLU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PLU0
Domain Number 1 Region: 3674-3816
Classification Level Classification E-value
Superfamily SET domain 4.84e-48
Family Histone lysine methyltransferases 0.0044
Further Details:      
 
Domain Number 2 Region: 1324-1394
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000142
Family PHD domain 0.0092
Further Details:      
 
Domain Number 3 Region: 1424-1492
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000184
Family PHD domain 0.0094
Further Details:      
 
Domain Number 4 Region: 1561-1625
Classification Level Classification E-value
Superfamily Bromodomain 0.00000523
Family Bromodomain 0.0051
Further Details:      
 
Weak hits

Sequence:  F1PLU0
Domain Number - Region: 1285-1337
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000864
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1PLU0
Sequence length 3819
Comment (tr|F1PLU0|F1PLU0_CANLF) Histone-lysine N-methyltransferase {ECO:0000256|PIRNR:PIRNR010354} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=KMT2A OC=Canis.
Sequence
DEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSALLSDPSVFSPLNKSET
KSGEKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGSKEESLKKIKRTPSATF
QQATKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPPGLLINSDL
EKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRIIPSSKRTDATIAKQLLQRAKKGAQ
KKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLE
STPNSRFSATSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEDQIQVLPEER
SETPEVHTPLPISQSPENDSSDRRSRRYSVSERSFGSRTAKKLSTLQSAPQQQPSSSPPP
PLLTPPPPLQPASGISDHTPWLMPPTIPLASPFLPASAAPMQGKRKSILREPTFRWTSLK
HSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLH
SGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPTNRTSAGTSSSGVSNRKRKRKVFSP
IRSEPRSPSHSMRTRSGRLSTAELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSL
TQSGESAEKSQRPRKQASTPAEPFSSGSPTPLFPWFTPGSQTERGRNKDKAPEEPSKDRD
ADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQSSSALYPVGRVSKDKVGAEDVAA
SSSAKKAAGRKKSSSIDSGTDIASVTLGDTTAVKTKILIKKGRGNLEKNNLDLGPTAPSL
EKEKTLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSL
KQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEEREK
ILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQV
PEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTS
EKKESKESNVGKCVVDSGQKPAPSAREDPAPKKSNSEPPPRKPVEEKSEEGNTSAPVPES
KQVTTPASRKSSKQASQPAPVTPPQPPSTAPPRKEVPKTTPSEPKKKQPPPPEAGPEQSK
QKKVAPRPSIPVKQKPKEKEKPPPVSKQENTGTLNILSTLSNGNSSKQKIPADGVHRIRV
DFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEEN
ERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKK
VWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYES
KMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEKELQLS
LKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQEDQ
QPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQME
RVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPPLMKKI
IPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDS
ANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATV
GCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEG
ISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARK
RCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTSFAEISSKESQNTADIVSPPSPD
RPHSQTSGSCFYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLS
SGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGGTYTRNSAPSVSTTGTATDLESSAKAVD
QVLGPLNSNTNLGQNTPTSSSLQRTVVTLGTKSSHVDGSSSSELKHSSASDLAPKSSSLK
GEKTKGPSSKSSEGSAHTMAYPGIPKLAPQVHNTASGELNASKIGTFTDLSSGPFSSKEA
LSFPPLHLRGQRNDRDQHTDSNQSVNPSSEEDTEVKTLKLSGVSNRSSIINEHVGSSSRD
RRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFVDEVLTPEFMGQRPCNNVSS
DKIGDKVLSLPGAPKAPSLQVEGSTKELQTPRKRTVKVTLTPLKMESEGQSKNTPKEGSP
VSPLQMESASPTEPVSASESPGDGPVAQPSPNNTSSQDPQSNSYQNLPVQDRNLMLPDGP
KPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQ
VDGADDLSTSDEDDLYYYNFTRTVISSGGDERLASHNLFREEEQCDLPKISQLDGVDDGT
ESDTSVTATTRKSSQIPKRNGKENGTENLKIERPEDAGEKEHVIKSSVGHKNEPKMDNCH
SVSRVKAQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNI
LPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTA
EPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITE
KSVTSSEGDSALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNSQDLTR
NSSTPGLQVPVSPTVPIQNQKYVPNSTESPGPSQISNAAVQTTPPHLKPATEKLIVVNQN
MQPLYVLQTLPNGVTQKIQLTSSVSSTPNVMETNTSVLGPMGSGLTLATGLNPSLPTSPS
LFPPASKGLLPMPHHQHLHSFPAAAQSSFPPNISSPSGLLIGVQPPPDPQLLVSEASQRT
DLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLPNH
PNLLDLGSLNTSSHRTVPNIIKRSKSGIMYFEQAPLLPQSVGGTAAAAAGTSTISQDTSH
LTAGPVSGLASGSSVLNVVSMQTTTTPTSSASVPGHVALTNPRLLGTPDIGSISNLLIKA
SQQSLGMQDQPVALPPSSGMFPQLGTSQTPAATMTAASSICVLPSAQTTGITAASPSGEA
EEHYQLQHVNQLLASKTGILPSQHDLDSAPGTQGSNFTQTVDAPNSMGLEQNKALSSAMQ
ASSASPGGSPSSGQQSASPSVPGPTKPKQKIKRFQLPLDKGNGKKHKVSHLRTSSEAHIP
DQEANTTSLTPVTGTPGAEAEPQDTAKVEQSSQKECGQPTGQILPEVQTTQNPANEQEST
EPKTVEEEENNFSSPLMLWLQQEQKRKESIAEKKPKKGLVFEISSDDGFQICAESIEDAW
KSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKP
EEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRAT
SMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDK
REKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFA
MRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN
Download sequence
Identical sequences F1PLU0
ENSCAFP00000018720 ENSCAFP00000018720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]