SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PN49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PN49
Domain Number 1 Region: 137-164,196-415
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-75
Family Nuclear receptor ligand-binding domain 0.00000000264
Further Details:      
 
Domain Number 2 Region: 85-168
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.83e-31
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1PN49
Sequence length 462
Comment (tr|F1PN49|F1PN49_CANLF) Retinoic acid receptor alpha {ECO:0000313|Ensembl:ENSCAFP00000010481} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=RARA OC=Canis.
Sequence
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEAPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Download sequence
Identical sequences F1PN49 G9KK78
ENSMPUP00000014752 ENSMPUP00000014752 XP_004395071.1.74151 XP_004395072.1.74151 XP_004764652.1.14098 XP_004764653.1.14098 XP_005624393.1.84170 XP_005624394.1.84170 ENSCAFP00000010481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]