SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PNA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PNA8
Domain Number 1 Region: 152-373
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-52
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 376-508
Classification Level Classification E-value
Superfamily PH domain-like 1.76e-23
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1PNA8
Sequence length 788
Comment (tr|F1PNA8|F1PNA8_CANLF) Pleckstrin homology and RhoGEF domain containing G6 {ECO:0000313|Ensembl:ENSCAFP00000022410} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=PLEKHG6 OC=Canis.
Sequence
MQTFAPSDESPFRGLVASRIETYGGRHQASNQSFPGGPYFRGGPGLDPSGRRLQGYVPFA
KGSGHVRSVSPLKLREPEPEKKHGGHFGAGPPHSPKVKEVTNAHQLEMRLHTFSMFGMPR
LPPEDRRYWEIGEGSDNGLVIEKSWKELVPGHKEMSRELCHQQEAIWELLTTELTYVRKL
KIMTDLLVSGLLNLQRVELLTEVSAETLFGNIPSLIRVHKSFWEEVLGPTLEETRTSGRP
LDPVSLQNGFLTFSQRFQPYVQYCLQVKRTMAYAREQQDNNPLFHAFVQWCEKHKRSGRQ
MLGDLLIKPHQRITKYPLLLQAVLKRSPEAHAREALNTMIAAVESFLRHINQQVRQGEEQ
ESLVAAAQRIGPYEVLEPSSEEVEKNLRPFCTLDLMSPMLGVASEHIRQLLLEGPVRVKE
GREGKLDVYLFLFSDVLLVTKPQRKADRAKVIRPPLMLEKLVCQPLRDPNSFLVIHLTDF
QCVSSAFIVHCPSATDCAQWLKKTQQAQATLQKLKAEEYVQQKRELLALYRDQDQPSSPS
PPSPPSPEGSQSSAEGRTPEFSTIIPQLVVTEDTDEDSPSVPDDTSDSGYGTLISGSPKG
PHYVSRLRPQALRRDPRLTFSTLDLRDVPLRPRPANPQAPQRRSAPELPRQVIRRGSSLP
RGDTPTWSEEEDGTSVGGNVVVETLHRAQLWGQHPPSPTHTDSAGESPWESSGDEEEVSH
FVGPDCTPSPRPLRAEDMLREIREELASQRIEGLQEPGNSRPRKLTRGQLQRMRGPYIIQ
LDTPLSTS
Download sequence
Identical sequences F1PNA8
ENSCAFP00000022410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]