SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PNM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PNM5
Domain Number 1 Region: 20-144
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-19
Family Pleckstrin-homology domain (PH domain) 0.075
Further Details:      
 
Weak hits

Sequence:  F1PNM5
Domain Number - Region: 287-382
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.0047
Further Details:      
 
Domain Number - Region: 178-269
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.0575
Family Oxygen-evolving enhancer protein 3, 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1PNM5
Sequence length 422
Comment (tr|F1PNM5|F1PNM5_CANLF) Pleckstrin homology and coiled-coil domain containing D1 {ECO:0000313|Ensembl:ENSCAFP00000032340} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=PLEKHD1 OC=Canis.
Sequence
MFTSKSNSVSPSPSLEQAESDALDISTKVQLYGVLWKRPFGRPSAKWSRRFFIIKESFLL
YYSESEKKNFETNKYFNIHPKGVIPLGGCLVEAKEEPSMPYAMKISHQDFHGNILLAAES
EFEQTQWLEMLQESGKVTWKNAQLGEAMIKSLEAQGLQLAKEKQEYLDKLMEETEELCLQ
REQREELERLNQVLEAEKQQFEEVVQELKMEQEQIKRELELTARCLKGVEQEKKELRHLT
ESLQQTLEELSIEKKKTLAMLEENENQLQTLANQSEQPPPSGGLHSNLRQIEEKMQQLLE
EKLLAEKRMKENEERSRALEEEREFYSSQSQALQNSLQELTAEKQQAERELKAEVKVRMD
LERRLREAEGALRSLEQGLNSKVRNKEKEERMRADVSHLKSKPCPRXXXXXXXXXXXXXX
XX
Download sequence
Identical sequences F1PNM5
ENSCAFP00000032340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]