SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PNX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PNX3
Domain Number 1 Region: 83-188
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-38
Family Second domain of FERM 0.000037
Further Details:      
 
Domain Number 2 Region: 186-304
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-32
Family Third domain of FERM 0.00071
Further Details:      
 
Domain Number 3 Region: 10-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.75e-17
Family First domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1PNX3
Sequence length 665
Comment (tr|F1PNX3|F1PNX3_CANLF) Erythrocyte membrane protein band 4.1 like 4A {ECO:0000313|Ensembl:ENSCAFP00000010938} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=EPB41L4A OC=Canis.
Sequence
MVLILFCKYVENRKSKSTKGSVVLDHVFRHVNLVEIDYFGLRYCDRSHQTYWLDPARTLA
EHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQL
GAYAIQAELGDYDPYKHTTGYVSEYRFVPDQKEELEEAIERIHKTLMGQTPSEAELNYLR
TAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVGKYFWPRITKVHFKETQFE
LRVLGKDCNETSFFFEARSKTACKHLWKCSVEHHTFFRMPESESSSLSRRLSKFGSAGYK
HRRRTASQRSRGLCVELPRPDQNVARSRSKTYPKRAAQTQPAGPQGASPGPADAEDGGSG
GAARILAPSPVKSFKKAKNENSPDAQRSKSQVPWDENGPQSGLYNSPGDRVKSPKFPSAR
RRNPSCGSDDSVQPTRRRKAQNSGEDSDLKQRRRSRSRCNTSSGSESESSHREHRKKRHR
IRQENDMVDSAPQWEAVLRRQKEKTQADPNNRRSRHRSRSRSPDIQAKEELWKHIQKELV
DPSGLSEEQLKEIPYTKVETQGDPVRIRHSHSPRSYRQYRRSQCSDGERSVLSEMNSKTE
LVPPLPVTRSSDAQGSGGSTVHQTRNGSKDSLMEEKSQTSTSNLAGKHTAKTVKTVQASR
LRTET
Download sequence
Identical sequences F1PNX3
ENSCAFP00000010938 ENSCAFP00000010938 XP_005618092.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]