SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PRU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PRU9
Domain Number 1 Region: 82-532
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.62e-96
Family Integrin alpha N-terminal domain 0.000000000000393
Further Details:      
 
Domain Number 2 Region: 824-1048
Classification Level Classification E-value
Superfamily Integrin domains 4.13e-54
Family Integrin domains 0.00032
Further Details:      
 
Domain Number 3 Region: 685-818
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-34
Family Integrin domains 0.00012
Further Details:      
 
Domain Number 4 Region: 532-684
Classification Level Classification E-value
Superfamily Integrin domains 3.35e-34
Family Integrin domains 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1PRU9
Sequence length 1085
Comment (tr|F1PRU9|F1PRU9_CANLF) Integrin subunit alpha 2b {ECO:0000313|Ensembl:ENSCAFP00000020854} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=ITGA2B OC=Canis.
Sequence
MVPGPVALSSAYCSASEFQSDKKSLPVVETERKRRQLAHSCPGDCGRRKMARAVCPLNAL
WLLEWVQLFLGPGAIPLGWALNLDPVQLTFYTGPNGSHFGFSLDFYKDNHGRVAFVVGAP
RTLGRSQEETGGVFLCPWRAEGGQCTSLPFDLNDETRHIGSHTFQTFKSRQGLGASVVSW
NDNIVACAPWQHWNVLEKTEEAEKTPVGGCFVAQLRNGHRAEYSPCRANTMSSVYVKNRF
NQDKRYCEAGFSAAVTQAGVLVLGAPGGYFFLGLLVRTPIDNIISSYRPGTLLWHVSSQS
FTYDYSKPEYYDGYRGYSVAVGEFDGNLNTTEYVLGAPTWSCTLGAVEILNEYHQTLHRL
HGEQMASYFGHSIAVTDVNGDGRHDLLVGAPLFMESRADRKLAEVGRVYLFLQPRGHQAL
GAPSLLLTGTQLYGRFGSAIASLGDLDRDGYNDVAVAAPYGGPSSLGQVLVYLGQSEGLS
SRPSQILDSPFPAGSGFGFSLRGATDIDDNGYPDLLVGAYGASKVAVYRAQPVVVANVQL
LVQDSLNPAVKNCILPQTKTPVSCFNIQMCMGATGHNIPQQLPLNAELQLDRQKPRQGRR
VLLLNSQLASSTLHLDLGGRHSPICHTTTAFLRDEADFRDKLSPIVLSLNVSLQPGKDGV
APAIVLHGDTHVQEQTRIILDCGEDDLCVPQLQLTAIVMGSPLLIGADNVLELQMDAANE
GEGAYEAELAVHLPPGAHYMRAISNIEGFERLICNQKKENETKIVLCELGNPMKRNARIG
ITMLVSVENLEEAGEHVSFWLQIRSKNSQNPNSEAVLLDVPVRAEAHVKLRGNSFPASLV
VVAEEDNRENSSESWGPKVEHTYELHNNGPGTVSGLHLHLCFPGESQPSDLLYILDIQPE
GGLQCSPQPSINPFKLDWRQPTPSPSPTSPGYHKRERRQASLPGSSQPSGLQDPVLLSCK
SGPHTVVQCELQEMARGQRAMVKVLAFLQLPSLQQRPLDQFVLESQAWFNVSSLPYAVPS
LSLPSGETLVQTHLLRALEERDIPIWWVLVGVLGGLLLLMLLVLAMWKGGFFKRNRPPLE
EEEEE
Download sequence
Identical sequences F1PRU9
ENSCAFP00000020854 ENSCAFP00000020854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]