SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PS17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PS17
Domain Number 1 Region: 178-290
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-37
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Domain Number 2 Region: 95-193
Classification Level Classification E-value
Superfamily PDZ domain-like 9.07e-24
Family PDZ domain 0.00018
Further Details:      
 
Domain Number 3 Region: 311-425
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000352
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1PS17
Sequence length 530
Comment (tr|F1PS17|F1PS17_CANLF) Syntrophin beta 1 {ECO:0000313|Ensembl:ENSCAFP00000001366} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=SNTB1 OC=Canis.
Sequence
MAVAAAAAAGPSGGGGGRAPRSGPLEVLVRDRWHKVLVNLGEDALVLSCEEGAAASNGLG
TATNGAFCRGAGGAQPPDSPAGVRTAFTDLPEQVPEAISNQKRGVKVLKQELGGLGISIK
GGKENKMPILISKIFKGLAADQTQALYVGDAILSVNGADLRDATHDEAVQALKRAGREVL
LEVKYMREATPYVKKGSPVSEIGWETPPPESPRLGASSSDPLSSQPCSFHRDRKSIPLKM
CYVTRSMASADPENRQLEIHSPDAKHTVILRSKDSATAQAWFSAIHSNVSDLLTQVIAEV
REQLGKTGIAGSREIRHLGWLADKVPGESEKQWKPALVVLTEKDLLIYDSMPRRKEAWFS
PVHTYPLLATRLVHSGPGKGSPQAGADLSFATRTGTRQGIETHLFRAETSRDLSHWTRSI
VQGCHNSAELVTEVTTACTYKNQECRLTVHYENGFSITTEPQEGAFPKTIIQSPYEKLKM
SSDDGIRMLYLDFGGKDGEIQLDLHSCPKPIVFIIHSFLSAKITRLGLVA
Download sequence
Identical sequences F1PS17
ENSCAFP00000001366 XP_013974080.1.84170 XP_539151.2.84170 ENSCAFP00000001366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]