SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PS48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PS48
Domain Number 1 Region: 375-505
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-36
Family Ran-binding domain 0.00000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1PS48
Sequence length 557
Comment (tr|F1PS48|F1PS48_CANLF) RAN binding protein 3 {ECO:0000313|Ensembl:ENSCAFP00000027650} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=RANBP3 OC=Canis.
Sequence
MADLANEEKPAIAPPVFVFQKDKGQKSSAEQKDLSDSGEEPRGEAEAPHHGTGHPESAGE
HALEPPAPASASASTPEAQLLPFPRELAGRSAGGSEATGPVDSDREDGNYCPPVKRERTS
SLTQFPPSQSEEKSSGFRLKPPTLIHGQAPSAGLPSQKPKEQQRSVLRPAVLQAPQPKAL
SQTVPSSGTNGVSIPADCTGAMTATSPDNPARRSPSDEVRALEEKEPQKNESSDTCEEEN
CEKREQVAQQAFVFGQNLRDRVKLTNENTEVADMENAGHPSSETPTATNYFLQYISSSLD
NSTNSADTASNKFVFGQNMSERVLSPPKLNEVSSDATRENAAAESGSESSSQEATPEKES
LAESAAAYTKATARKCLLEKVEVITGEEAESNVLQIQCKLFVFDKASQSWVERGRGLLRL
NDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDTEDQGVKVF
LISASSKDTGQLYAALHHRILALRSRVEQEQEAKMPAPEPGAAPSNEDDSDEDVLAPSGA
TGGGASEEGDGQTAGST
Download sequence
Identical sequences F1PS48
ENSCAFP00000027650 ENSCAFP00000027650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]