SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PW82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PW82
Domain Number 1 Region: 584-672
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-19
Family Third domain of FERM 0.0049
Further Details:      
 
Domain Number 2 Region: 398-491
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-17
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 3 Region: 303-349,527-583
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000977
Family Second domain of FERM 0.0049
Further Details:      
 
Weak hits

Sequence:  F1PW82
Domain Number - Region: 36-107
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00233
Family Ubiquitin-related 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1PW82
Sequence length 695
Comment (tr|F1PW82|F1PW82_CANLF) Fermitin family member 1 {ECO:0000313|Ensembl:ENSCAFP00000008898} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=FERMT1 OC=Canis.
Sequence
MSVTPILNLLPEIPAFATMLSSSDFVSASWELIVRVDDPNEEEQKDVTLRVSGDLHVGGV
MLKLVEQIKISQDWSDFALWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKILRLRLP
NVKTVRLRVSFSAVVFKAVSDICKILNIRRSEELSLLKPSGDYFKKKKKKDKSNKEPIIE
DILNLECSPTTVGPPVSPGLYSKTMTPTYDPISGTPASSTMTWFSDSPLTEQNCSILAFS
QPPQSPEALADMYQPRSLVDKAKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYTFFDLNP
KYDAVRINQLYEQARWAILLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFTNESEVDE
VEAALSNLEVTLEGGKTDNTLEDITDIPKLADNLKLFRPKKLMLKAFKQYWFIFKDTSIA
YFKNKELEQGEPIEKLNLRGCEVVPDVNVAGRKFGIKLLIPVADGMNEVYLRCDHENQYA
QWMAACILASKGKTMADSSYQPEVLNILSFLRMKNRNVSSQVASNLESMDMNPECFVSPR
CAKKQKSKQLAARILEAHQNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDI
LGVSYNRLIRIDATTGIPITTWRFTNMKQWNVNWEIRQVAIEFDQNVSIAFTCLSADCKI
VHEYIGGYIFLSTRSKDQNETLDEDLFHKLTGGQE
Download sequence
Identical sequences F1PW82
ENSCAFP00000008898 XP_005634859.1.84170 ENSCAFP00000008898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]