SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PWS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PWS8
Domain Number 1 Region: 485-739
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-50
Family YWTD domain 0.00000421
Further Details:      
 
Domain Number 2 Region: 46-306
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-35
Family YWTD domain 0.0000998
Further Details:      
 
Domain Number 3 Region: 403-478,735-785
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000022
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 746-784,838-927
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000102
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 314-410
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 975-1021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000571
Family EGF-type module 0.00041
Further Details:      
 
Domain Number 7 Region: 910-955
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000131
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1PWS8
Sequence length 1216
Comment (tr|F1PWS8|F1PWS8_CANLF) Pro-epidermal growth factor {ECO:0000256|PIRNR:PIRNR001778} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=EGF OC=Canis.
Sequence
MLLPLIILWPVVFKCSFASLSDPENWNCPEVSPSGKGSPACVGPAPFLIFSHGISIFRID
LEGTNHEQLVADAGVSVIMDFHYNKERIYWVDPERQLLQRVFLNGTRQERVCNIEKNVSG
MAINWINEELIWSNQQEGIITVTDMKGNNSRVLLRALNYPANVAIDPIERFIFWSSEVAV
AGSLHRADLNGVEEKILLQTSERITAVSLDVLDKQLFWIQYSRDGSNSHIYSCNYDGGSV
HLSKHLTQHNFFAMSLFGNQIFYSTWKKKTIWIANKHSGKDMVRINLDSSFVPPGGIKVV
HPLLQPKAESGTWSPDQKLCKWKQGNCRGSTCGQDSKSYSCTCAEGYTLSQDGKYCEDVN
ECAFWNHGCTLGCENIPGSYYCTCPVGFILLPDGKRCHQLIACPSNTSKCSHDCVLTSDG
PICFCPEGSVLEADGKTCSGCSSPDNGGCSQLCLPLSPVSWECGCFPGYDLQLDKQSCAA
SGPQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVFALDHDPVENKIYFAHTALKWIER
ANMDGSQRERLIEEGVDVPEGLAIDWIDRKFYWTDSGKSLIEGSDLNGKHREVIIKEDIS
QPRGIAVHPMAKRLFWTDMGINPRIESSSLQGIGRLVIASSDLVWPSGITIDYVTDKLYW
CDTKLSVIEMANLDGSKRQRLAQNDVGHPFAMAVFEDHVWFSDWTMPSIIRVDKRTGKNR
VRLRGSMLKPSSLVVVHPLAKPEGAQPCLYQNGGCEHICKERFGTAQCLCREGFVKAPDG
KMCLALNGHQIPAVGSEADLSNHVTPGDVLPRSEGFEDNITESQHMLVAEIMVSDADDCA
PVGCSTWAECVSEGENATCQCLKGFTGDGKLCFDIDECEMGITICPPTSSKCVNTEGGYV
CQCSEGYRGDGIHCLDINECQLGMHTCGENATCTNMEGNYTCMCAGSLSEPGQICADSTP
PSHPMEDSHYSVRNGYRECPSSYDGYCLYNGVCMYIEAVDRYACNCVFGYVGERCQHRDL
KWELRHAGQGRQRQVAAVAVGVAVLVLLLLLGLGGAHCYRTKKLSSKNLKNPYEEPSREG
SSSRPSDSEARMASFPQPWFVVIKEHQNLRNGSQPMALKDGESADVSRFSSPEPGSVKRT
SWRNEHQLYKDTEQGCCTPPSSNRGTGSQSMEQSFSVPSYEAQPIALGVEKPQSLLSAPL
LQQRAPDPPHQMKLIQ
Download sequence
Identical sequences F1PWS8
ENSCAFP00000016954 ENSCAFP00000038595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]