SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PWW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PWW9
Domain Number 1 Region: 89-292
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.37e-59
Family DBL homology domain (DH-domain) 0.0000215
Further Details:      
 
Domain Number 2 Region: 277-399
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-33
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1PWW9
Sequence length 1343
Comment (tr|F1PWW9|F1PWW9_CANLF) Pleckstrin homology and RhoGEF domain containing G3 {ECO:0000313|Ensembl:ENSCAFP00000023640} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=PLEKHG3 OC=Canis.
Sequence
MPVSASLRQDGSQERPVSLTSTTSSSGSSRDSRGAMEEPSGPEASAENGAGSPRGRHPAN
GDSGPSGWLSVRGPLSPFSSRAPAAPALKLSYLGRVVREIVETERMYVQDLRSIVEDYLL
KIIDTPGLLKPEQVSALFGNIENIYALNSQLLRDLDSCNSDPVAVASCFVERSQEFDIYT
QYCNNYPNSVAALTECMRDKQQAKFFRDRQELLQHSLPLGSYLLKPVQRILKYHLLLQEI
AKHFDEEEDGFEVVEDAIDTMTCVAWYINDMKRRHEHAVRLQEIQSLLINWKGPDLTIYG
ELVLEGTFRVHRVRNERTFFLFDKALLITKKRGDHFVYKGHIPCSSLMLIESTRDSLCFT
VTHYKHSKQQYNIQAKTAEEKRSWTHHIKRLILENHHTTIPQKAKEAILEMDSYYPSRYR
CSPERLKKAWSSQDEVSTHVRQGRRQSEPTRHLLRQLSEKARAAGMKHAGSAGALLDFGQ
PPCAQGVQPETEGAAQEEQEEEEEEEEEEEEEEEEEEVVVEEEEEKAFQVSLEDLAGPEG
SEKGARLEPPGSEEEEEEEESLAVAEQVADFASSLLAALHCWHYRANALLFSRGAMEKGR
KESEGPKSRRRSSGRSPTSAEKRMSFESTSSLPEVEPVPDPEMEQEVFAAMEGPSIEEVP
SDTESPEVLETQLDAHQDLLGLAPPGDMGDFVVVESTEDLKALSSEEEDEDVRAAQETES
LLPPSVLDQASIIAERFVSSFSRRSSLALEDGKASGFGSPRLISRSSSVLSLEGSEKGPA
WHGSTTDSLGSQLPPEVDATVGVAMESGPPVNGTEPPSPGCLAEPDRSSCKKKESTLSTR
DRLLLDKIKSYYENAEHHDAGFSIRRRESLSYIPKGLVRNSVSRFNSLPRPDPEPMAPLG
HKRPVGSRPPSWALFDLPGPSQASAGEPAPITDAEFRPSSEIVKIWEGMESAGESSRKGP
GQGQANGFDLHEPLFILEEHELGAITEESATASPESASPTERPSPAHLARELKELVKELS
SGVQGELVAPLHPRIVQLSHVMDGHVSERVKNKVYQLARQYSLRIKSKSVTARPPLQWGK
VAPTVPCLQEEAGAPSGGTGKRKPVLPLLNHEQTAAQEHSPPKPGSPRLFAFSPTAASPK
ASSAAPRPSSRSPLSPFDAEPFSWPDVRELCSKYASHDEAFQAEGSRPRGPPVNRSRSVP
ENMVEPPPAGRVGRCCSVGARRGRPGPEAAQPQLPGMLPQSRPVEDEALYVTADLTLENN
QRVIVLEKGPLPCPAAGLEERSGQGPSSPAATMRRGLDFQETGVSRSPEYWPKEEGPRDP
ADPGQQGRVRNLREKFQALNSIG
Download sequence
Identical sequences F1PWW9
ENSCAFP00000023640 ENSCAFP00000023640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]