SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PXG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PXG8
Domain Number 1 Region: 371-588
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.13e-53
Family DBL homology domain (DH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 889-1136
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000977
Family WD40-repeat 0.033
Further Details:      
 
Domain Number 3 Region: 620-677,770-827
Classification Level Classification E-value
Superfamily PH domain-like 0.00000307
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1PXG8
Sequence length 1156
Comment (tr|F1PXG8|F1PXG8_CANLF) Rho guanine nucleotide exchange factor 10 {ECO:0000313|Ensembl:ENSCAFP00000020133} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=ARHGEF10 OC=Canis.
Sequence
PLDAEVKCDPNNNEDDEGEQFDFDSGDEIPEADRAATDAPGDSRPGTDAAPGPPGGDVGM
GTAPDALLEPTPPPPRVNPYSVIDITPFQEEQPPPADAEAEAESASPPVPSGYSVPVPCG
YAVPCNLPLLLPAYSNPVVIRAPSLDEEETQEVAQDSQFNSLSSEDPANSEDRVHKEDSA
LARWVADPANTAWMENPEEAIYDDVPRENSDSEPDEMIYDDVENGEEGGNSSLEYGWSSS
EFESYEEQSDSECKNGVPRSFLRSNHKKQLSHDLTRFKEHYEKKMRALVADAVGASETQQ
LKQRHEPKMQKLMKAAKEGTKDGLEKTKAAVKRGRSLIRTRSFMAADHRSCLEEEQNLFI
DVECKHPEAILTPMPEGLSQQQVVRRYILGSVVDSEKNYVDALKRILEQYEKPLSEMEPK
ILSERKLKMVFFRVKELLQCHGMFQIALASRVAEWDSVETIGDVFVASFSKSMVLDAYSE
YVNNFSTAVAILKKTCATKPAFLEFLKQCQESSPDRVTLYSLMMKPIQRFPQFILLLQDM
LKNTSKGHPDRLPLQMALTELETLAEKLNERKRDADQRCEIKHVAKAINERYLNKLLSSG
NRYLVRSDDMIETVYNDRGEIIKTKERRVFMLSDVLMCATVSARTSDSSTIMSSSQRYLL
KWSVPLGHVEVIEYGSNDGAGESRCPPVHPPESLAVVANAKPNQVYVGPGQLYQDLQNLL
HDLNVVGQISQLIGNLRGNYQNLNQAVAHDWTAGLQRLILKKEEEIRAADCCRIQLQLPG
KQDKSGRPTFFTAVFNTFTPAIKESWISNLQMAKLALEEENHMGWFCVEDDGNQIKKERH
PLLVGHMPVTVAKQQEFKIECAAYNPEPCVTSEAQPDSLSTVHGFLWIGSCTSQMGQVAI
VSFQNCNPKVIECFNVESRILCMVFIPAEERPAEPEATAGRASGVPTVCLGTEEGSISIY
KSSQGCKKVRLQQFFAPDKSTVLSLACTPQSLYAGLVNGAVAVYGKAEDGSWNSEPQKVI
KLGVLPVRSLVMAEDTLWAASGGQVFTVSTETHAIESQLEAHQEEGMVVSHMVIAGVGIW
LAFTSGSTLRLFHTETLKHLQDINVATPVHHMLPGHQRLSVTSLLVCHGLLMVGTSVGIV
VALPVPRLQGIPKVTG
Download sequence
Identical sequences F1PXG8
ENSCAFP00000020133 ENSCAFP00000021211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]