SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PYA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F1PYA8
Domain Number - Region: 1-45
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.000146
Family Pyk2-associated protein beta ARF-GAP domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1PYA8
Sequence length 349
Comment (tr|F1PYA8|F1PYA8_CANLF) Small ArfGAP2 {ECO:0000313|Ensembl:ENSCAFP00000004444} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=SMAP2 OC=Canis.
Sequence
MQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDK
WKRGSEPAPEKKMEPVVFEKVKMPQKKEDPQLPRKSSPKSSAPVMDLLGLDAPVSCSIAN
SKTSNTLEKDLDLLASVPSPSSSVSRKVVGSMPTAGSAGSVPENLNLFPEPGSKSEETGK
KQLSKDSILSLYGSQTPQMPAQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGM
VAQPGASGMVAPMAMPAGYMGGMQASMMGVPNGMMTTQQAGYMAGMAAVPQTMYGVQPAQ
QLQWNLTQMTQQMAGMNFCGAHGMLSYGQSMNGGNGQAANQTLSPQMWK
Download sequence
Identical sequences F1PYA8
ENSCAFP00000004444 XP_005628935.1.84170 XP_013975029.1.84170 XP_539575.3.84170 ENSCAFP00000004444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]