SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PYE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PYE7
Domain Number 1 Region: 112-236
Classification Level Classification E-value
Superfamily Cyclin-like 0.000000000000116
Family Cyclin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1PYE7
Sequence length 312
Comment (tr|F1PYE7|F1PYE7_CANLF) Cyclin Y like 1 {ECO:0000313|Ensembl:ENSCAFP00000019942} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=CCNYL1 OC=Canis.
Sequence
MGNTLTCCVSSNASPKLGRGTGPADPDYESDVYQAAAGDAVAVAPAPATVEPAELDFGAG
EGHHLQHISDREMPEDLALESNPSDHPRASTIFLSKSQTDVREKRKSNHLNHCDLSNILP
HKEQREKVPEEYFKHDPEHKFIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICP
TNWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNEMERHFLELLQFNINVPSS
VYAKYYFDLRSLADDNNVNFLFAPLSKERAQNLEAISRLCEDKYKDWSRAAMRRSFSADN
FIGIQRSNAILS
Download sequence
Identical sequences F1PYE7
XP_545613.3.84170 ENSCAFP00000019942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]