SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PYU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PYU8
Domain Number 1 Region: 295-352
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000748
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 
Domain Number 2 Region: 368-488
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000631
Family Pleckstrin-homology domain (PH domain) 0.04
Further Details:      
 
Domain Number 3 Region: 520-772
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000000837
Family Tricorn protease domain 2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1PYU8
Sequence length 1018
Comment (tr|F1PYU8|F1PYU8_CANLF) CDC42 binding protein kinase alpha {ECO:0000313|Ensembl:ENSCAFP00000023578} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=CDC42BPA OC=Canis.
Sequence
VIFQDRSICSNYVSQSEREEFENEFKQQYEREKVLLTEENKKLTSELDKLTTLYENVSMR
NQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSS
LGARATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKASNIITECKLKD
SEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQFETDPVESTY
VRNPNVKVNVQSRSTSPSTSSEAEPLKIVDSTPLPAHTPTLRKKGCPGSTGFPAKRKTHQ
FFVKSFTTPTRCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKAPTACPVPPEQTKGPLG
IDPQKGIGTAYEGHVRIPKPAGVKKGWQRALAVVCDFKLFLYDVAEGKASQPSVVVSQVI
DMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSASDSRCSVLMLAESESERNKWVG
VLNELHKILKKSKFRDRSVYVPKEAYDSTLPLIKTTQAAAIIDHERIALGNEEGLFVVHI
TKDEIIRVGDNKKIHQIELIPNDQLVAVISGRNRHVRLFPISALDGRETDFYKLAETKGC
QTITSGKVCHGALTCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPYNVQWMAIFSEQLCV
GFQSGFLRYPLNGEGSPYSMLHSNDHTLSFIAHQPMDAICAVEISSKEYLLCFNSIGIYT
DCQGRRSRQQELMWPSNPSSCCYNAPYLSVYSENAVDIFDVNSMEWIQTLPLKKVRPLNS
EGSLNLLGLETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNINNKRRFSFRVPEEERM
QQRREMLRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPMNPRPQESRTVFSGSVSI
PSITKSRPEPGRSMSASSGLSARSSAQNGSALKREFSGGSYNAKWQPMPSPSEGSLSSGG
MDQGSDAPARDYDGEDSDSPRHSTASNSSNLSSPPSPVSPRKTKSLSLESTDRGTWDP
Download sequence
Identical sequences F1PYU8
ENSCAFP00000023578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]