SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PZ05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PZ05
Domain Number 1 Region: 585-752
Classification Level Classification E-value
Superfamily Sec7 domain 1.83e-57
Family Sec7 domain 0.0000462
Further Details:      
 
Domain Number 2 Region: 798-933
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-28
Family Pleckstrin-homology domain (PH domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1PZ05
Sequence length 1060
Comment (tr|F1PZ05|F1PZ05_CANLF) Pleckstrin and Sec7 domain containing 3 {ECO:0000313|Ensembl:ENSCAFP00000007929} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=PSD3 OC=Canis.
Sequence
MYEGMILSHRKDGKLAIYDNMDGPRMYYAETFVWVNNASAHSQSVAKAKYEFLFGRSEEK
PPNTSDHGGSTLLPPNVTNEFPEYGTMEESGDGLRASLGFDTESLSGAPRGQQGVQFVDG
PHCRLNNVTEGPQDGRESHPRCQLKEQSLQPIDDLISTLKATEARIASGTLQATKVLEKN
AVSSFSTQQVEEKLDTAPYKTERQRANKIFPAGQEKGPDVPLSAEVTTEENSYSSIQKDV
TVLLAGEAQVELCRITDDARKGALHVQGPAGPASSVGSPAAAHASVGTVGFLREMRSDQG
SSTGRPGRVKHVEFQGVEILWTGGEKREPQQPVDFEISLERTAPPESREFPRVPSHLISS
AGLYNSVGLTESVWDETWSASSEKPGASSGAFSPLPLVDSGEDEVFLKENKEHLEKKPEL
ERDKERILEQEEHFGGGDDDLLGHGYAEDSTDVYSSQFETILDNTSLYYSAESLETLYSE
PDSYFSFDMPLTPMIQQRIKEGTQFLERTSVAGQQDVLSISAVGEIVMGCSSEIANGLND
TSDPIYTKGTPEIAFWGSNAGVKTTLLEAHSEMGSTEILEKEASESLSNGTRSNVEAARR
LARRLYQLDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVG
ETQERERVLIHFSNRYFYCNPDAIASQDGVHCLTCAMMLLNTDLHGHNIGKKMTCQEFIA
NLQGVNEGGDFSKDLLKALYNSIKNEKLEWAVDDEEKKKSPSEGTDEKANGTHPKTISRI
GSTTNPFLDIPHDPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQK
DEYKPEKALSEEDLKNAVSVHHALASKATDYEKKPNVLKLKTADWRVLLFQAQSPEEMQG
WINKINCVAAVFSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELA
EHRSYPPDKKVKAKEIDEYRLKDHYLEFEKTRYEIYVSILKEGGKELLSNNESEAVGLKK
SHSSPSLNPDSSPVTAKVKRNVSERKDHRPETPSIKQKVT
Download sequence
Identical sequences F1PZ05
ENSCAFP00000007929 ENSCAFP00000007929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]