SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1PZJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PZJ6
Domain Number 1 Region: 34-139
Classification Level Classification E-value
Superfamily Cyclin-like 4.77e-27
Family Cyclin 0.0059
Further Details:      
 
Domain Number 2 Region: 142-247
Classification Level Classification E-value
Superfamily Cyclin-like 4.7e-26
Family Cyclin 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1PZJ6
Sequence length 251
Comment (tr|F1PZJ6|F1PZJ6_CANLF) Cyclin Q {ECO:0000313|Ensembl:ENSCAFP00000028374} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=CCNQ OC=Canis.
Sequence
AGPVAPPSSRTPGAGRRALGAPCPSCRGSWASGRGLMEAPGVKLGMQSIPIATACTIYHK
FFCEIDLDAYDPYLVAMSSLYLAGKVEEQHLRTRDIINVSNRYFHPGSEPLELDSRFWAL
RDSIVQCELLMLRVLRFQVSFQHPHKYLLHYLISLKNWLNRYSWQRTPVSVTAWALLRDS
YHGGLCLRFRAQHIAVAVIHLALQAYGVEVPAEAEAEKPWWQVFSDDLTQPIIDNIVSDL
IQIYTMDTEIP
Download sequence
Identical sequences F1PZJ6
ENSCAFP00000028374 ENSCAFP00000028374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]