SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1Q028 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1Q028
Domain Number 1 Region: 292-512
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-56
Family DBL homology domain (DH-domain) 0.0000738
Further Details:      
 
Domain Number 2 Region: 502-642
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-18
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 3 Region: 655-715
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000708
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1Q028
Sequence length 735
Comment (tr|F1Q028|F1Q028_CANLF) Rho guanine nucleotide exchange factor 16 {ECO:0000313|Ensembl:ENSCAFP00000028797} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=ARHGEF16 OC=Canis.
Sequence
MVLRGPGADPTWICRPPGHWPVSMSQRHSDSSLEEKLLEYRFHSELRLDAKGNPASGLPM
VRGSLQVVRDNAPFQVDTSGPPPLSPKDQESRTVILSTQSPAALKMGTQQLIPRSLAVSS
KAKTPARHQSFGAAVLSKEAARRDPQLLSAPSFSLDDMDVDMGSEGALRRNLRNRSYRAA
MKGLGAPSGDRGPSQLSPKLQALAEEPSQPSARGPAKNKFAQKTLGRKRAHKGSFKDDPG
FYQEIRERGLNTSHESDDDMLDEPPSPDGTGRADAPIVVKSYRPAQITWSQLPEVVESGL
LDTLPPEERKRQEAIFEILTSEFSYQHSLSILVAEFLHSRQLRATMTQTEHHHLFSNILD
VLSASQRFFEDLEQRHKAQVCVEDISDILEEHAEKHFHPYVVYCSNEVYQQRALQKLTSS
NAAFHEALKEIEKRPACGGLPMISFLILPMQRVTRLPLLTDTLCLKSQGHPERYKAASRA
LKAISKLVRQCNEGAHKMERTEQMYTLHTQLDFGKVKSLPLISASRWLLKRGELFVVEET
GIFRKLASRPTCYLFLFNDVLVITKKKSEDSFLVQDYAQVDHIRVQKMEPSDPSLVGGSS
RSSLVPHVFQVTMLHNSEGRQEKILLSSDSASDRARWITALTHRERQGRGPTNKGDLLQV
EVTKAYLAKQADEITLQQADVVLVLEQEDGWFYGERLRDGEMGWFPEDFARCITSRVAVE
GNVRRMERLRVETGV
Download sequence
Identical sequences F1Q028
ENSCAFP00000028797 ENSCAFP00000028797 XP_005620490.1.84170 XP_005620491.1.84170 XP_005620492.1.84170 XP_013969349.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]