SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1Q178 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1Q178
Domain Number 1 Region: 1388-1567
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.19e-41
Family DBL homology domain (DH-domain) 0.0000495
Further Details:      
 
Domain Number 2 Region: 1577-1692
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-35
Family Pleckstrin-homology domain (PH domain) 0.00044
Further Details:      
 
Weak hits

Sequence:  F1Q178
Domain Number - Region: 701-855
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0144
Family CRAL/TRIO domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1Q178
Sequence length 1812
Comment (tr|F1Q178|F1Q178_CANLF) Uncharacterized protein {ECO:0000313|Ensembl:ENSCAFP00000016281} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN= OC=Canis.
Sequence
QDLESLDTCIQNTLSALYPPFEATSATVLWQLFSVAERLHGGDGLRCLTDFLIPAKRALQ
HLQQEACARYTGLIFVHEGWPLCVHEKVVVQLASLRGVRLRPGDFYLQVTSVGKQSARLV
LKCLSQLGRGSEEVAVPEAMYSCVFTGQFLEWLNGERNSVPLQNCLLTSGSAVFRTPWSS
VTDPVFVPTRQLPRDPASTEVRRGFRKSYMEALRNPMPLGSSSEESLGDEACSTQTTGAR
VVSGPAQKATPSPWGDSVELPSQERRSGTTRSTLPRRSRSWDRSVRSSRGATRQASRHSV
SARLGGLLGGRVEGTSSAGSSCPPCSTAESPGNAHPCPFLPLPHPSPQSVFLDALYLSSG
RLTQEKSVSTSTWTVDNMTCKESLQGIKNEKIKKCSVMKKSSDFGGSKEQEPSEGRVTPG
IWVQRTSRGFFAEAHLAHPPARQHFVKNTVLAPVIQAENTVPCTLDNAVKTHVCSSSWRG
DGLCLPAKLTLKCNQVHVSPQRNASCTDAVCAHLGGGSTGHRHLTTTRTPGGSGFRSYKP
GLAALCMSISDCPEPWKKEDPVEKRVVLTPTRSWMGPQRSEQKGLNDCSPIVSTLAATVM
FQFYVYSCPTAQEHTCPVRCATLLFATRNEDILLVFMASFDQGSFCHPARVDADSSTFLK
RDPSQVSDVLVDPVCREGGGQLPSTGAVPSQVPRQLLEVSQDLLQSGVITLPGTRDHQGR
AVVQVCTRGPLWSSAHPSSVELTRLLQYLHGIPRKEVRELGLVILVDARKGPATPALSQA
LAVLQNTSPPIIHSIVLLVNKESAFRPDKDGTIECEVVGSLKALHKLVDSSQLTADLDGS
FPYSHSDWICFRRKLESFTTDCEDAIVFLQNSVHSLNIHRTLSTAQEVTDLINKHKAMMK
CVLEDALLVALRLEGGTMLARLKREQLGSSQDYQDAIKVASRLYNQVDEEVHGLVLTSNR
CLQELERLREIRMLQEGRGQVKMAIPHTGRLAQLEFSLLSSALRGLCSVDHFLLFYPEVL
RSCLSNYDLKEERNSWPLGAALPEEQAAAARVLDLPKPADGVSTPEDTHRNRVSTRLMLV
VSSWATAEEAIWDFRQCLSTGLSGCREHWPEGPICLTSAVESPPRDLHVVDRWMLQCGEC
LGHLGPQPVAEYLNCWHQEATELTTQSFPGASMAVAGLGSPQALHRWHPLWLQSQHTQLC
FQEALSGATPDPGTPPLGRRPLKHELGQEAERRPHEPSWTPSTDLECPAGEQAPLLPGLP
GQASLRRQEDEHLAPGVHSPHDSPTCSPEPIQTPASHPRKHSLKKTMRKTQSFEIPQLDS
GLRDSHWPGHTGVFIRGLEVTSTVASEKKPPSRPHAESPLVTRNQSLSSPSRTHPSKEDG
NKQAGSSRLQHIMAEMVSTEREYVRSLGYVIDHYFPEMERTDLPQDLRGKHSIVFGNLEN
LYDFHRQHFLAELERCQHCPLAAGRGFLRHEEQFGMYALYSKNKPQSDALLCSHGNAFFK
DKQRQLGDKMDLASYLLKPVQRMGKYALLLQDLVREAGRCPVPEQELSELRAAQGVVRFQ
LRHGNDLLAMDAVRGCDVNLKEQGQLRCQDEFIVCCGRKKYLRHVFLFEDLILFSKTRKV
DGGYDTYTYKQSFKTAEIGMTENIGDSGLRFEIWFRRRRKSQDTYVLQASSAEVKMAWTH
VIGQILWRQALRNRELRMQEMVSMGIGNKPFVDIQPSDAAVNDRAIKAAELWTRAPVAVP
PCDRATPFKRPHSTISDSSTSSSSSQSSSVLGPLSPHTSASPALLSTASCPWPHNMRTCL
EEEEELELETGS
Download sequence
Identical sequences F1Q178
ENSCAFP00000016281 ENSCAFP00000016281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]