SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1Q1Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1Q1Q2
Domain Number 1 Region: 298-404
Classification Level Classification E-value
Superfamily Cyclin-like 9.97e-27
Family Cyclin 0.001
Further Details:      
 
Domain Number 2 Region: 407-529
Classification Level Classification E-value
Superfamily Cyclin-like 1.66e-25
Family Cyclin 0.0035
Further Details:      
 
Domain Number 3 Region: 32-113
Classification Level Classification E-value
Superfamily F-box domain 0.00000000615
Family F-box domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1Q1Q2
Sequence length 783
Comment (tr|F1Q1Q2|F1Q1Q2_CANLF) Cyclin F {ECO:0000313|Ensembl:ENSCAFP00000028622} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=CCNF OC=Canis.
Sequence
MGSGGVIHCRCAKCFCYPTKRRIRRRPRNLTILSLPEDVLFHILKWLSVGDILAVRAVHS
HLKYLVDNHASVWACASFQELWPSPRNLKLFERAAEKGNFEAAVKLGIAYLYNEGLSVSD
EARAEVNGLKASRFFSLAERLNVGATPFIWLFIRPPWSVSGSCCKAVVHESLRAECQLQG
THRASLLHCLGRVLSLFEDEERKQQAQDLFEESANQGCLVSSYLLWERDRRTDMSDPGRC
LYSFRKLRDYAAKGCWEAQLSLAKACAHGSQLGLEAKASDAVVRQLFQTSRAVGKQQVFS
VQKGLSDTMRYILIDWLVEVATMKDFTSLCLHLTVECVDRYLRRRLVPRYRLQLLGIACM
VICTRFISKEILTIREAVWLTDNTYKYEDLVRMMGEIISALEGKIRVPTVVDYKDVLLTL
VPVAPRTQHLCSFLCELSLLHTSLAVYAPARLAAAALLLARLTHGQTQPWTTRLWDLTGF
SSEDLIPCVLSLHQKCFHDDAPKDYRQVSLTAVKQRFEDKRYEEISQEEVLSYGQLCAAL
GVKQGSPEPASFLNTGDIHAFLSSPSGRRTKRKRENSLQEDRGSFVTTPTAELSSQEEML
LGSFLDWSLDYCSGYEGDQESEGEKDGDVTAPSGILDVTVVYLSPEQHCCQESSDEEACP
EDRGHQDPRTWVPGPQMPPTPEPEPQLCGTRKPGRDSVTSGYSSISSASPTNSVDGVSGG
PPQSTSVPSPGSDLNTQFCHHHAKKSCLQCRSPGPLESSVPQVKRKSLCTHSEEEEEGDV
SQA
Download sequence
Identical sequences F1Q1Q2
ENSCAFP00000028622 ENSCAFP00000028622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]