SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1Q2Y3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1Q2Y3
Domain Number 1 Region: 63-370
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-86
Family Protein kinases, catalytic subunit 0.000000000135
Further Details:      
 
Domain Number 2 Region: 338-358,433-554
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-45
Family Pleckstrin-homology domain (PH domain) 0.000000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1Q2Y3
Sequence length 558
Comment (tr|F1Q2Y3|F1Q2Y3_CANLF) 3-phosphoinositide dependent protein kinase 1 {ECO:0000313|Ensembl:ENSCAFP00000028594} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=PDPK1 OC=Canis.
Sequence
LDQVVSRLYDTVPIQSSVVLCSCPSPSMVRTQTESGTAPGIPSGGSRQAPTMDSTAAESR
PSTNSLQHTTQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHI
IKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFD
ETCTRFYTAEMVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQAR
ANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLE
YDFPEKFFPKARDLVEKLLVLDATKRLGCEEMGGYSPLRAHPFFESITWENLQHQTPPKL
TAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDAGLPQMAGSNIEQYIHD
LDTNSFELDLEFSEDEKRLLLEKQASGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLL
TEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKK
IQEVWRHRYQSHPDAAVQ
Download sequence
Identical sequences F1Q2Y3
9615.ENSCAFP00000028594 ENSCAFP00000028594 ENSCAFP00000028594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]