SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1Q3X7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1Q3X7
Domain Number 1 Region: 146-275
Classification Level Classification E-value
Superfamily Cyclin-like 3.67e-52
Family Cyclin 0.000000356
Further Details:      
 
Domain Number 2 Region: 10-144
Classification Level Classification E-value
Superfamily Cyclin-like 7.78e-45
Family Cyclin 0.000000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1Q3X7
Sequence length 313
Comment (tr|F1Q3X7|F1Q3X7_CANLF) Cyclin E1 {ECO:0000313|Ensembl:ENSCAFP00000011293} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=CCNE1 OC=Canis.
Sequence
MPSRASPLPLLNWANRDEVWKIMLNKEKTYLRDKHFMQRHPLLQPKMRAILLDWLMEVCE
VYKLHRETFYLAQDFFDRYMATQQNIVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVT
DGACSGEEILSMELIIMKALKWHLSPLTIVSWLNVYMQVAYLNDLYEVLLPQYPQQIFIQ
IAELLDLCVLDVGCLEFPYGVLAASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMV
IRETGSSKLKHFRGVPAEDAHNIQTHINSLDLLDKAQAKKAILSEQNRISPPPTGVLTPP
QSSKKQSSGQDTA
Download sequence
Identical sequences F1Q3X7
ENSCAFP00000011293 ENSCAFP00000011293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]