SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1Q443 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1Q443
Domain Number 1 Region: 382-605
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-40
Family DBL homology domain (DH-domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 609-742
Classification Level Classification E-value
Superfamily PH domain-like 1.95e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 3 Region: 135-223
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000258
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1Q443
Sequence length 1070
Comment (tr|F1Q443|F1Q443_CANLF) Pleckstrin homology and RhoGEF domain containing G5 {ECO:0000313|Ensembl:ENSCAFP00000028990} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=PLEKHG5 OC=Canis.
Sequence
MGTGPGVSGRRAASRPGPGLPCRPGGRARDGEGQVCHHADCQQLHRRGPLNLCEACDSKF
HSAMHYDGHVRFDLPPQGSILARNVSTRSCPPRTSPAVDLEEEEESSMDGKGDRKSTGLK
LSKKARRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGEVLLPVFERKGIALGKVD
IYLDQSNTPLSLTFEAYRFGGHYLRVKAKPGDEGKVEQGVKDSKSLSLPILRPARAGTPS
LERVDPQSRRESLDILAPGRRRKNMSEFLGETSIPGQEASTPSSCSLPSGSSGGSDSWKN
RAASRFSGFFSSGPSTSTFGREVDKMEQLEAKLHTYGLFGLPRLPRRLRFDHDSWEEEGD
EEEEEDDACLWLEDSWRELIDGHEKLTRRQCHQQEAEWHLAESHPSSARTLNVVCPQLFL
CCLLNLQESGLLCEVEAERLFSNIPELARLHRGLWAGTMAPVLEKARRTRALLQPGDFLR
GFKMFGSLFRPYIRYCMEEEGCMEYMRGLLRDNELFRAYVTWAEKHQQCQRLKLSDMLAK
PHQRLTKYPLLLKSVLRKTDEPRAKEAVVTMIDSVERFIHHVNACMRQRQERQRLAAVVS
RIDAYEVVEGSNDEVDKLLKEFLHLDLTAPIPGASPEETRQLLLEGSLRMKEGKDSKMDV
YCFLFTDLLLVTKAVKKAERTKVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYT
FQASGQALCRGWVEAIYNAQNQLQQLRVQEHPGSQQPLQSLEEEDDEQEEEDEEDEDEEE
EEGGGSSTSAASSPTILRKSSNSLNSQHCASDGSTETLAMVVVEPGETLSSPEFEGGPFG
SQSDETSLSTTASSVTPISELLPLGPVDGRSCSMDSAYGTLSPTSLQDFMAPAPVAEPLP
RPPELPQAPSPLSSPRLRRRSPVQLLPRLPHLLKSKSEASLLQLLSGATTSGAPPAPSRS
LSELCLAVAGRGTRTQGSSREPGPSWVRQGTPSPSSGPEPSELEGRTSCLAGEPERPTRR
SRDLPLGASPRVQPEPPPGISAQHRKLTLAQLYRIRTTLLLNSTLTASEV
Download sequence
Identical sequences F1Q443
ENSCAFP00000028990 ENSCAFP00000037969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]