SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1Q445 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1Q445
Domain Number 1 Region: 105-307,356-438,475-500
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.22e-56
Family Diacylglycerol kinase-like 0.0043
Further Details:      
 
Weak hits

Sequence:  F1Q445
Domain Number - Region: 27-106
Classification Level Classification E-value
Superfamily PH domain-like 0.0198
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1Q445
Sequence length 513
Comment (tr|F1Q445|F1Q445_CANLF) Ceramide kinase {ECO:0000313|Ensembl:ENSCAFP00000001057} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=CERK OC=Canis.
Sequence
AREASCWWRWPHGARPGAGAPGGDACSVPISEIITVEETDTRGKHYGSGKWQKMEKPFAF
TVHCVKRARRHRWKWAQVTFCCAEEPLCHLWLQTLQELLDKLTSRPKHLLVFINPFGGKG
QGKRIYERKVAPLFTLASITTEIIVTERANQAKESLYEINIDKYDGIICVGGDGMFSEIL
HGLIGRTQRNAGVDQNQPRAALVPSPLRIGIIPAGSTDCVCFSTVGTNDAETSALHIIVG
DSLPMDVSSVHHNSTLLRYSVSLLGYGFYGDIIKDSEKKRWMGLIRYDFSGLKTFLSHHC
YEGTVSFLPARHTVGSPRDRKPCRAGCFVCRQSKQQLEEEQKRSLYGLENTEEVEEWKVV
CGKFLAINATNMCCACPRSPSGLSPAAHLGDGSSDLILIRKCSRFNFLRFLVRHTNQYDQ
FDFAFVEVYRVKKFQFTSSHMEEEDSDLKERGKKRFGQMCSEHPSCCCSVSNSSWNCDGE
ILSSSSIEVRVHCQLVRLFARGIEENPKEELDS
Download sequence
Identical sequences F1Q445
ENSCAFP00000001057 ENSCAFP00000001057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]