SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1Q4R1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F1Q4R1
Domain Number - Region: 1201-1273,1344-1388,1441-1628
Classification Level Classification E-value
Superfamily ARM repeat 0.000264
Family HspBP1 domain 0.055
Further Details:      
 
Domain Number - Region: 599-664
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0748
Family Synaptotagmin-like (S variant) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1Q4R1
Sequence length 2114
Comment (tr|F1Q4R1|F1Q4R1_DANRE) Dedicator of cytokinesis 6 {ECO:0000313|Ensembl:ENSDARP00000077379} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=si:dkey-114l24.1 OC=Cyprinidae; Danio.
Sequence
MATLTSERRAFAHKINRTVASEVRKQVSREYGSPQMSKKRAGAHQPVPLTEVVEPVDYEE
YVSSHPPGAEPGPLRQLLEFPRDDLELVLQERECVTIEPPVPEEDSLDPRVRDALGVYTD
DWLIIQRKYQCYSTLQTPHNSERQREKQKGLVKQTFELDEAAIERQDEQDDPKRHSVSLD
DTPRGSWASSIFDLKNSIPDALLPSVLERTAAEEMDRRNADNRQQGRHNHLLGLYPAPDE
DEAVERCAIPEVPKEHSGQRIMVKCLSLKFEIEIEPIFGSLALYDVREKKKISEDFHFDL
NSDQMKGLLRPHNPHVAISTLARSAIFSITYPSPEIFLVIKLEKVLQQGDIGECCEPYMV
MKESDSIKHKEKLEKLRAQAEQMCSRLGGFRMPFAWTAIHLLNIVSSVGGLDRSDSDSDT
ERKGTWNERKKKGFERMSVGEDMCNFTNFRPATLTVTNFFKQEGDRLSDEDLYKFLADMR
RPSSVLRRLRPVTAQLKIDISPAPEAPHYCLSPELLHVKPYPDPRVRPTKEVLEFPARYV
YTPHTTYRNLLYVYPQSVNFSSRQGSVRNIAVKVQFMAGEDPSQAMPVIFGKSSCAEFYK
EAYTPVIYHNKSPEFYEEVKMKIPANLTDNHHLLFTFYHISCQPKQNTLLETPVGYTWIP
LMQHGRLRSGSFSLPVSVEKPPPSYSVLTPDVQLPGMKWVDNHKGVFNVEVKAASSVHTQ
DPHLDKFFTLVYVLEEYSFPFRLKDVIITESNVEAELKASMAALKGALLDTCVRFLHQLM
SKLILLIVHPPVIAGQIVNLGRAAFEAMALLVNQIHKNLEGNQDHHGRNNLLSSYIHYCF
HLPTTEPVSPPAVGAAAYDLPIHYATLSRATSRPSALLLSRSKSISNSNPDLASTPATPD
EEVQRIIGSKGIDRSHSWVNSAYAPGGSRAVLRRNPNSSCELKQASERACNRMSAYIETT
SLLCPPSRQIAKKLLHEELALQWVVSTSTVREASLQQAWFFFQLMVKSMSHHLFLSSRLD
MPRRQRFPDRFVDDIAALVCAISADIASRYHKDVELVERLNSSLAFFLNDLLSLMDRGFV
FNLVRSYYKQINNKLHTAQNPSSLTALRMDFIRIICSHEHYVILNLPCATLSPPASPSPS
TSSTTSQSSAFSSHAQDQGVVSMFELSVPFRQQHFLSGLLLAELSLILEPDGESVFFLHK
KAISALHSLLCSHDADPRYTDPQVRSHVAQLYLPLIPIIMETLPKLHDFTDTSPQRVRHA
SALADDNDPDNGTISQSVAMAIAGSPLPHSKANPFTLPSVAGRQCGVLSAECSRTLLVCF
LWVWKNADAGLLERWVSDLSVPQINRLLDLLHLCLSCFEYKGKKALERINSLTFKKSQDM
KARLEEAILGTIGARQEMVRRCRERSPYGGQENVRWRKNVTHWRQNADRVDKTKAEVEQE
SVVDGNLATEAALIALDTLEIIVKTVVMSELKESVLGGVLRVLLHSMAGNQSALFLQHCF
STQRALVYKFPEMLFEEDTELCADLCLRLLRHCSSSVSSVRSHASASLYLLMRQNFEIGN
NFARVKMQVTMSLSSLVGTSQTFNEEHLRRSLKTILTYAEDDLELRDSPFPEQVQDLVFN
LHMILTDTVKMKEHQQDPEMLIDLMYRIAKGYQNSPDLRLTWLQNMAGKHSEKGNHAEAA
HCLVHSAALVAEYLNMLEDCRYLPIGCVSFQSISSNVLEESAVSDDILSPEEEGICSGKY
FSESGLVGLLEQAAASFNMAAMYEAINEVYKILCPIHEANRDFKKLASVHGKLQDAFNKV
YNQSSGWERMFGTYFRVGFYGCRFGDLDEQEFVYKEPSITKLAEISHRLEEFYSERFGDE
VVAIIKDSNPVDKNKLDPNKAYLQITYVEPFFDTYELKERITYFDKNYNLRTFMYCTPFT
LDGRAHGDLHEQYKRKTILTTSHAFPYIKTRINVIHKEEIILMPMEVAIEDMQKKTQELA
FATHQDPADPKMLQMVLQGCVGTTVNQGPLEVAQVFLSEIPEDPKLFRHHNKLRLCFKDF
TKRCEDALRKNKSLIGPDQKEYHRELERNYLKLKEALFPLINRKIPQLYRPLPLPTLPTQ
RNSLSRSSFRRLEC
Download sequence
Identical sequences F1Q4R1
ENSDARP00000077379 ENSDARP00000077379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]