SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1Q8Q4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1Q8Q4
Domain Number 1 Region: 142-353
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.71e-67
Family Arfaptin, Rac-binding fragment 0.00097
Further Details:      
 
Domain Number 2 Region: 16-99
Classification Level Classification E-value
Superfamily PDZ domain-like 5.78e-18
Family PDZ domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1Q8Q4
Sequence length 406
Comment (tr|F1Q8Q4|F1Q8Q4_DANRE) Protein-interacting with prkca 1 {ECO:0000313|Ensembl:ENSDARP00000095747} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=pick1 OC=Cyprinidae; Danio.
Sequence
MFTDMDYELEEDKLGIPTVPGTVTLKKDSQNLIGISIGGGAQFCPCLYIVQVFDNTAAAL
DGTLAAGDEITGVNGKPVKGKTKVEVAKMIQAVQGEVVIQYNKLQADPKQGKSLDIVLKK
VKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELEKTAELYKGLMEHTKRLLRAFYEL
SQTHRAFGDVFSVIGVREPQAAASEAFVKFAEAHRNMEKFGIQLLKTIKPMLHDLNTYLH
KAIPDTKLTIRKYLDVKFEYLSYCLKVKEMDDEEYSCIALGDPLYRVSTGNYEYRLVLRC
RQEARARFAKMRKDVLEKIELLDQKHVQDIVFQLQRFVSGMSHYYDDCYAVLKDADVFPI
EVDLSRTMINYSGQSLTYEDEDEEESSRAQSQQQEENGAEKLIDDQ
Download sequence
Identical sequences F1Q8Q4
ENSDARP00000095747 ENSDARP00000107411 7955.ENSDARP00000095747 ENSDARP00000095747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]