SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1Q973 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1Q973
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.43e-82
Family BAR domain 0.0008
Further Details:      
 
Domain Number 2 Region: 400-515
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.27e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.00014
Further Details:      
 
Domain Number 3 Region: 235-361
Classification Level Classification E-value
Superfamily PH domain-like 5.79e-28
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 
Domain Number 4 Region: 641-759
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.71e-25
Family Ankyrin repeat 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1Q973
Sequence length 802
Comment (tr|F1Q973|F1Q973_DANRE) ArfGAP with coiled-coil, ankyrin repeat and PH domains 2 {ECO:0000313|Ensembl:ENSDARP00000080366} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=si:dkey-254a11.3 OC=Cyprinidae; Danio.
Sequence
MKITVDFEECLKDSPRFRATIEEVEGDVCELESKLDKLVKLCIGMIDAGKAYNTANKQFV
SGIRELAQQSATDDVIESSLSTFAENLQEMINYHTILFDQAQRSIKSQLQTFIREDLRKF
KEAKKQFDKVSEEKEAALSKNAQAPRNKAHEVEEASNILNATRKCFRHIVLDYVLQINVL
QSKRRSEILKSMLSFMYAHLTFFHQGYDLFSELQPLMKQLTGQLDQLVLDATKERKDMET
KHSTIQQKEFSNDDTKLEYNVDAENGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQK
KFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMMQADSEKLRQAWIKAVQNSI
ATAFRDKADDAEKMDRKSSTSTGSLDSAGDVKEKCVKGENALQRVMAISGNSSCCDCGQP
EPRWASINLGITLCIQCSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNGVINQIYE
ARREELGARKPNAGDPRHEVEAYIKAKYVERRFVQRRSEDEIRQKVLLLSKEDKHPSGCS
DTQTTRSVSKPRLASSSSVHLESLFCVDELDSLFSYFTSSGQTRCLRSSDGEAQTLTEES
RETVNASASTSTVNHTDEEGCCGKAVVVFCEPQQATAGLQLYWASFSRSLPDMAEALAHG
AQVNWTNTEQDNRTPLIMAVHGGSLVTCEFLLQNSASVNQLDSWGRGPLHHATILGHTGQ
VCLFLKRGANQNAADVENQTPLSIAVEAANADIVTLLRLAKMNEEMRESEGPYSQSGDET
YQDIFQDFTQMASNDPDKLNRY
Download sequence
Identical sequences F1Q973
ENSDARP00000080366 ENSDARP00000080366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]