SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1Q9F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1Q9F3
Domain Number 1 Region: 529-874
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.91e-89
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00000558
Further Details:      
 
Domain Number 2 Region: 265-409,464-511
Classification Level Classification E-value
Superfamily ARM repeat 6.62e-64
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00029
Further Details:      
 
Domain Number 3 Region: 35-162
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.75e-39
Family PLC-like (P variant) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1Q9F3
Sequence length 878
Comment (tr|F1Q9F3|F1Q9F3_DANRE) Phosphatidylinositol 3-kinase, catalytic subunit type 3 {ECO:0000313|Ensembl:ENSDARP00000092039} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=pik3c3 OC=Cyprinidae; Danio.
Sequence
MDTDKFNYVYSCDLDINVQLKIGSLEGKREQKSYKALLEDPMLRFSGLYQESCSDLYVTC
QVFAEGKPLALPVRTSYKAFSTRWNWNEWLRLPVKYPDLPQSAQVTLTVWDVYGPGRATP
VGGTTVTLFGKYGMFRQGMHDLKVWPGVEGDGTEPTSTPGRTSSSLAEDQMGRLAKLTKA
HRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFPRVKSGEREYSIVYYEKDAD
ESSPLPTSSDIVKVPDPQMCMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIVS
YPPTKQLSSEEQDLVWKFRYYLTTQEKALTKFLKCVNWDLPQEAKQALELLGKWRPMDVE
DSLELLSSQFTNPTVRRYAVARLQQADDEDLLMYLLQLVQALKYENFNDIQGGLEPANKR
DNQGGLTESSTTGDLDSSQLASAIAVMPSSQKGKEGTDGENLEQDLCTFLISRACKNSTL
ANYLYWYVIVECEDQDTQQRDPKTHDMYLNVMRRFSQALLKGDKSVRVMRSLLASQQTFV
DRLVQLMKAVQRESGNRKKKTERLQSLLADNEKVNLSEIEPIPLPLEPQIRIKGIIPETA
TLFKSALMPAKLIFKTEDGEQYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTP
YKVLATSTKHGFMQFVQSVPVAEVLATEGNIQSFFRKYAPNDKGPYGISSEVMDTYVKSC
AGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLSKEMVEGMGG
MQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLD
LSDEEAVHYMQSLIDESVGALFAAVVEQIHKFAQYWRR
Download sequence
Identical sequences F1Q9F3
NP_001315462.1.45394 ENSDARP00000092039 ENSDARP00000092039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]