SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1QBI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1QBI5
Domain Number 1 Region: 34-271,303-328
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.45e-67
Family BAR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 542-690
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.11e-66
Family Ankyrin repeat 0.00000166
Further Details:      
 
Domain Number 3 Region: 419-536
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.24e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.00000823
Further Details:      
 
Domain Number 4 Region: 291-410
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-21
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 
Domain Number 5 Region: 1056-1130
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000123
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1QBI5
Sequence length 1132
Comment (tr|F1QBI5|F1QBI5_DANRE) ArfGAP with SH3 domain, ankyrin repeat and PH domain 1a {ECO:0000313|Ensembl:ENSDARP00000120481} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=si:ch211-160i2.3 OC=Cyprinidae; Danio.
Sequence
XMPDQISVSEFLSETTEDYNSPTTSSFTTRLQSCRNTVNVLEEALDQDRTALQKVKKSVK
AIYNSGQEHVQNEENYGQALDKFGSNFISRDNSDLGTAFIKFSGLIKELAALLKNLLQSL
SHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEIT
GAEIAEEMEKERRIFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTAD
KLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLDQKEDSQSKQSGYSMHQLQG
NKEFGSEKKGYLFKKSDGIRKVWQRRKCSVKNGILTISHATSNRQPVRLNLLTCQVKPSG
EDKKCFDLISHNRTYHFQAEDEQEFVIWISVLTNSKEEALNMAFRGEQSAGDDSLEDLTK
AIIEDVLRIPGNEVCCDCGAPEPKWLSTNLGILTCIECSGIHREMGVHISRIQSMELDKL
GTSELLLAKNVGNSSFNEILEGNLPSPSPKPAPSSDMTERKEYINAKYVEHRFARRTATT
ATARQGDLYEAVRTRDLMALIQLYADGVELMDPFPEAGQDPGETALHFAVRTSDQTSLHL
VDFLVQNSGTLDRQTESGNAALHYCCTYEKPECLKLLLRGKPSIDLVNQNGETALDIARR
LRNVQCEELLVEAAAGRFNPHVHVEYEWNLRLEEIDESDDDLDDKPSPVKKERSPRPQSF
CHSSSVSPQEKLTLPGYLGHRDKQRLSYGAFANPVYSTSTETPASPVSEGPTIASKTPAK
APSCGPPTSLPLGSQSSAGGSSTLSKKRAPPPPPGHKRTHSDPPSPVLQGPQSKGSESTP
PSANRTSPANKFEGIQQQQSTTSMNTKATFGPRVLPKLPQKVALRKIDTIHLPSVDKSGP
DVLQKPPQAQDAPPTRASDTITRPTEPPPKIPQVAERSQPVDVPQKPHISDLPPKPQLSD
LPPKPQLSDLPPKPQLSDLPPKPQLKDLPPKPQISDLPSKPAVCSASEATQRQSTQEETS
PKPQLTETQSFSQQEELSPRQASEDTNGAPAGALEMPVPMPRKINTVAKNKAKRVKTIYD
CQADNDDELTFVEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPMSFVHILSD
Download sequence
Identical sequences F1QBI5
ENSDARP00000120481 ENSDARP00000120481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]