SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1QGW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1QGW7
Domain Number 1 Region: 296-493
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-51
Family Ypt/Rab-GAP domain of gyp1p 0.0016
Further Details:      
 
Domain Number 2 Region: 470-591
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.28e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1QGW7
Sequence length 664
Comment (tr|F1QGW7|F1QGW7_DANRE) TBC1 domain family, member 15 {ECO:0000313|Ensembl:ENSDARP00000111457} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=tbc1d15 OC=Cyprinidae; Danio.
Sequence
XAATTPPKVVFEHEGVFIHSSPDESEDQDLISGFLRIVEKEGETLVEYKPLEDADPSNML
CACKDSSSVVEWTQSSEENPHRPVDHQLSYETEWDMINAVSFRRKVHANGDGGSNHVNEQ
NKRAFSFNVCDLRSVTVKCEGWSYLTFRLKDGTALPAIHFHQGGSKAFLDSLRKSVQINE
SPDDESVLIVSTYSKAFSQSFENLLDDTNYGFVQKFKKDPYTTTLGGFSKVTNYLFDAFR
APELECQQRPAEEVADVLGELIPGLEINQQEEPGFEVITRLDLGPRPEMQRTGPVTMEEW
AKYQDLEGRMTNLPHLKDAIFKGGLCHAVRKEAWKFLLGYFPWSSTHEERKLLQKRKTDE
YFRMKLQWKSVSEEQERRNSRLRDYRSLIEKDVNRTDRNNKFYEGLDNPGLILLHDILMT
YCMYDFDLGYVQGMSDLLSPILFVMENEVDAFWCFVSFMDEMHENFEEQMQGMKTQLIQL
STLLRLLDLAFWNYLEAQDSGYLYFCFRWLLIRFKRELHFQDVLRLWEVMWTRLPCQNFH
LLVCCAILDSEKQKIMDRKYGFNEILKHINELSMKLDIEEILSKSESICMQIKSCKDLPH
SVSEILGLNTVSEPSAALETSEYGILESPQTSPRSSHRQDHVVSNGHSHLKETTQNGCKV
AFIS
Download sequence
Identical sequences F1QGW7
ENSDARP00000111457 ENSDARP00000111457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]