SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1QJT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1QJT0
Domain Number 1 Region: 231-495
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.18e-83
Family Nuclear receptor ligand-binding domain 0.00000000153
Further Details:      
 
Domain Number 2 Region: 126-208
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.97e-26
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1QJT0
Sequence length 496
Comment (tr|F1QJT0|F1QJT0_DANRE) Peroxisome proliferator-activated receptor delta a {ECO:0000313|Ensembl:ENSDARP00000109331} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=pparda OC=Cyprinidae; Danio.
Sequence
MSVCEMDRRHVLALRSRLPRNLGSVGGVYMDPGDSSPCSSQGEGPDDQRLQDVLCELGEG
AGLNLELESEGGVALQGEELSWETSRQEEQSNTSSTSPDRSSASTDLSTALSEQLLRGRE
EVSGINMECRICGDRASGFHYGVHACEGCKGFFRRTIRMKLEYERCERSCKIQKKSRNKC
QFCRFQKCLMLGMSHDAIRYGRMPEAEKRKLVAGLLAGERGSQNSNESDLKTLAKRVNNA
YLKNLNMTKKKARNILTGKTSASTPFVIHDMDSLVQAENGLVWNQVIHGAPPNKEIGVHV
FYRCQCTTVETVRELTEFSKSIPGFIDLFLNDQVTLLKYGVHEAIFAMLPSLMNKDGLLV
ANGRGFVTREFLRSLRKPFSEIMEPKFEFAVKFNALELDDSDLALFVAAIILCGDRPGLM
NVHQVEKIQDSILQALNQHLQLNHPDGRFIFPRLLQKLADLRQLVTENAQLVQKIKKTES
ETSLHPLLQEIYRDMY
Download sequence
Identical sequences F1QJT0
ENSDARP00000109331 XP_699900.6.45394 ENSDARP00000109331 ENSDARP00000124414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]