SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1QMG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1QMG5
Domain Number 1 Region: 82-128
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000209
Family Hairy Orange domain 0.0055
Further Details:      
 
Domain Number 2 Region: 16-73
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000567
Family HLH, helix-loop-helix DNA-binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1QMG5
Sequence length 226
Comment (tr|F1QMG5|F1QMG5_DANRE) Hes family bHLH transcription factor 6 {ECO:0000313|Ensembl:ENSDARP00000021078} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=hes6 OC=Cyprinidae; Danio.
Sequence
MAPASRSNTHDEDYYGIKDRKTRKPLVEKKRRARINESLQELRLLLADPDAQVKMENAEV
LEMTVKRVESILQNKAKEADSVNREANERFAAGYIQCMHEVHTFVSSCPGIDATIAADLL
NHLLECMPLNDEERFQDILSDLISDSNNSGTWPGEAAYATLSPGGTSVANGGSSALSPAP
STTSSDDICSDLDDTDTEHSRISVDAGDQAPVVPTLYTNKSIWRPW
Download sequence
Identical sequences F1QMG5
ENSDARP00000021078 ENSDARP00000021078 7955.ENSDARP00000021078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]