SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1QQW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F1QQW7
Domain Number - Region: 223-267
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0165
Family Tudor domain 0.026
Further Details:      
 
Domain Number - Region: 157-207
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0602
Family Tudor domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1QQW7
Sequence length 293
Comment (tr|F1QQW7|F1QQW7_DANRE) SAGA complex-associated factor 29 {ECO:0000313|Ensembl:ENSDARP00000002714} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=ccdc101 OC=Cyprinidae; Danio.
Sequence
MALVSADTKIAELLNELHQLIKQTQEERSRSEHNLLNIQKTHERMQTENKTSPYYRTKLR
GLYTTAKADAEAECSILRRALDKIAEIKSLLEERRIAARMAGVYSDNDPPRKTMRRGVLM
TLLQQSAMTLPLWIGKPGESPPPLCGAIPASSDYVAKQGDKVAARVKAVDGDEQWILAEV
VSYNHSTNKYEVDDIDEEGKERHTLSRRRIIPLPQWKANPETDPEALFSKDQLVLALYPQ
TTCFYRALIHTPPHRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVACKENKKK
Download sequence
Identical sequences F1QQW7
7955.ENSDARP00000002714 ENSDARP00000002714 ENSDARP00000002714 XP_005163867.1.45394 XP_005163868.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]