SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1QT05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1QT05
Domain Number 1 Region: 38-109
Classification Level Classification E-value
Superfamily SAND domain-like 3.49e-24
Family SAND domain 0.00068
Further Details:      
 
Domain Number 2 Region: 153-241
Classification Level Classification E-value
Superfamily SAND domain-like 8.89e-22
Family SAND domain 0.0035
Further Details:      
 
Domain Number 3 Region: 247-301
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000247
Family PHD domain 0.0061
Further Details:      
 
Domain Number 4 Region: 323-407
Classification Level Classification E-value
Superfamily Bromodomain 0.00000602
Family Bromodomain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1QT05
Sequence length 408
Comment (tr|F1QT05|F1QT05_DANRE) Zgc:113411 {ECO:0000313|Ensembl:ENSDARP00000110770} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=zgc:113411 OC=Cyprinidae; Danio.
Sequence
MKKKSCKKSRQIRSSSICSSKRKKQAKSKNCLQSSSSQSRLPVTCGYKEGLLDLKKYYKR
QKCILSEDRWFTPTEFERFGRKEKNKKWRTSILCKGITLQKLIEDGFLLPKTFMKGRIHG
EKQKKRPEVLQQQVLESAEKSNGSQGEDDDDIDMTKFEGATLPVACGSNSGVLHKCRFAG
ERCGRCIRTENSWLTPEGFIKLNKPDGIWRKDIVSNGVPLGRLIKKKVLELHTINCDCEI
CQELDQHLNDDVCFVCNSEGNLVCCDECPRAFHHHCHLPAVPEDSSGKWSCIICVLKNMK
GSSQKNQQDIMSSPVSQYTQHCQCLLLHLLRECMTDPCTNIPGGSENICGPMMLGRVKQN
LENNNCPTVQVFVSDIEYVFHHCTSKRDNDFSRMMSRLMELLETIFKP
Download sequence
Identical sequences F1QT05
ENSDARP00000055589 NP_001017912.2.45394 ENSDARP00000055589 ENSDARP00000110770 7955.ENSDARP00000055589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]