SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1QX19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F1QX19
Domain Number - Region: 15-47,322-374
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0549
Family Ypt/Rab-GAP domain of gyp1p 0.015
Further Details:      
 
Domain Number - Region: 115-221
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 0.0549
Family MgtE membrane domain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1QX19
Sequence length 468
Comment (tr|F1QX19|F1QX19_DANRE) Zinc metallopeptidase, STE24 homolog {ECO:0000313|Ensembl:ENSDARP00000076630} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=zmpste24 OC=Cyprinidae; Danio.
Sequence
MLREILALSVEDKIFYAVLFFSWTVYVWEAYLAYRQRKIYRATVHVPTELGKIMDSETFE
KSRLYQLDKSNFGFWSGLYSEFEGTLILLLGGIPFLWKLSGHLTAHFGFGPEYEISQSLV
FLMLATLFSAFTGLPWSLYNTFVIEEKHGFNQQTLGFFLKDALKKFAVTQCILVPVTSLL
LYIIKIGGDYFFIYAWLFTFIVSLILVTIYADYIAPLFDKFTPLPDGELRSEIESMAKSI
SFPLTKLYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEDYSPLNQSGEKEPGTGEENE
AVVNESKAKPKNKKQGCSNPEVLAVLGHELGHWKLGHTVKNIVISQMNSFLCFFLFAVLI
GRKELFMAFGFHDTQPTLIGLMIIFQFIFSPYNELLSFCMTVLSRRFEFQADAFARGMGR
SSELYSALIKLNKDNLGFPVADWLFSMWHYSHPPLLERLRALTGPKQD
Download sequence
Identical sequences F1QX19
ENSDARP00000076630 ENSDARP00000076630 7955.ENSDARP00000076630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]