SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1QX49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1QX49
Domain Number 1 Region: 261-397
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.5e-42
Family Synaptotagmin-like (S variant) 0.0000023
Further Details:      
 
Domain Number 2 Region: 123-252
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.59e-42
Family Synaptotagmin-like (S variant) 0.0000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1QX49
Sequence length 410
Comment (tr|F1QX49|F1QX49_DANRE) Synaptotagmin Va {ECO:0000313|Ensembl:ENSDARP00000122114} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=syt5a OC=Cyprinidae; Danio.
Sequence
MRLASMQHRGRRAAESEEEPNRAPPPLPPPSHHSHNFVNMKNKFFNELGHLPNHKIRMPM
WAIGAIIVVVLALVGCFAFCIYKKCLGGKKKTKKVRERKGGRRRMKKEGEEEAGEEQPKE
GEGEGEKEYYGKLEYTLDYNFTENQLIVGILQAQDLPAMDIGGTSDPYVKVYMLPDKKKK
FETKVQRKNLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDVIGEIKIPMNSIDL
GQPIHEYKDLVGGEKEEQEKLGDICISLRYVPTSGKLTVCIMEAKNLKKMDVGGLSDPFV
KIVLQHNGKRIKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKVQVLITVYDYDKLGSNDP
IGKCWIGFGASGVGLRHWSDMLANPRRPVAQWHTLQPEEEVDAALKAPIR
Download sequence
Identical sequences F1QX49
ENSDARP00000122114 ENSDARP00000122114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]